DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and HSPA2

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_068814.2 Gene:HSPA2 HGNCID:5235 Length:639 Species:Homo sapiens

Alignment Length:652 Identity:531/653 (81%)
Similarity:583/653 (89%) Gaps:17/653 (3%)


  Fly     2 SKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQT 66
            ::.||:|||||||||||||||||||||||||||||||||||||||||||||||||||||||||.|
Human     3 ARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNT 67

  Fly    67 IFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETA 131
            ||||||||||||:||.||||||||||.|||..||||::|.||.|.||||||||||||||||||.|
Human    68 IFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEISSMVLTKMKEIA 132

  Fly   132 EAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKK--AVGERN 194
            |||||..|.:|||||||||||||||||||||||.|||||||||||||||||||||||  |.||:|
Human   133 EAYLGGKVHSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKN 197

  Fly   195 VLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRA 259
            ||||||||||||||||:|:|||||||||||||||||||||||:|:|..:|||||||||:..||||
Human   198 VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRA 262

  Fly   260 LRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDA 324
            :|||||||||||||||||||||||||||:||.||||||||||||||||||||.|::|||||||||
Human   263 VRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDA 327

  Fly   325 KLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQ 389
            ||||..|.:||||||||||||:|:||||.|||||||||||||||||||||||||||.||||:.||
Human   328 KLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQ 392

  Fly   390 DLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNN 454
            |||||||||||||||||||||:.|||||||||||||||||||||||..||:||||||||||||||
Human   393 DLLLLDVTPLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNN 457

  Fly   455 LLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMV 519
            |||||:|:||||||||||||||||||||||||||||.::||.||||||||||||||||:||:|||
Human   458 LLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMV 522

  Fly   520 NEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDAN 584
            .|||:|::|||..::.:||||.||||.:|:|.|::::.|:.|||:.|:..|||||.|.|.|||.|
Human   523 QEAERYKSEDEANRDRVAAKNALESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRN 587

  Fly   585 QLADKEEYEHRQKELEGVCNPIITKLYQGAGFPPGGMPGGPGGMPGAAGAAGAAGAGGAGPTIEE 649
            |:|:|:||||:|||||.||||||:||||          |||||  |:.|  |.:||.| ||||||
Human   588 QMAEKDEYEHKQKELERVCNPIISKLYQ----------GGPGG--GSGG--GGSGASG-GPTIEE 637

  Fly   650 VD 651
            ||
Human   638 VD 639

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 511/612 (83%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 332/377 (88%)
HSPA2NP_068814.2 PTZ00009 2..615 CDD:240227 511/612 (83%)
Nucleotide-binding domain (NBD). {ECO:0000250|UniProtKB:P11142} 2..389 337/386 (87%)
Substrate-binding domain (SBD). {ECO:0000250|UniProtKB:P11142} 397..512 104/115 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C281046519
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D180577at33208
OrthoFinder 1 1.000 FOG0000062
OrthoInspector 1 1.000 T608766
orthoMCL 1 0.900 OOG5_126588
Panther 1 1.100 O PTHR19375
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.