DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and hyou1

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_997868.1 Gene:hyou1 ZFINID:ZDB-GENE-030131-5344 Length:980 Species:Danio rerio

Alignment Length:720 Identity:201/721 (28%)
Similarity:333/721 (46%) Gaps:124/721 (17%)


  Fly     7 VGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDA 70
            :.:|||:.:..|.:.:.| .:||:.|.:..|.||..|...:.|||.||.|......||.......
Zfish    28 MSVDLGSEWMKVAIVKPGVPMEIVLNKESRRKTPVAVCLKENERLFGDGALGVAVKNPKVVYRFL 92

  Fly    71 KRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYK-DEKKTFFPEEISSMVLTKMKETAEAY 134
            :.::|:..|:..|....||:|...:..|.| :..|.:| .|:..:.|||:..|:|...:..|:.:
Zfish    93 QSILGKTADNPQVAEYQKHFPEHQLQKDEK-RGTVYFKFSEEMQYTPEELLGMILNYSRTLAQDF 156

  Fly   135 LGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGL-DKKAVGE--RNVL 196
            ..:.:.:||||||||||.::|:|...|..||||.||::||:.||.|:.||: .:|.:..  :|::
Zfish   157 AEQPIKDAVITVPAYFNQAERRAVLQAAHIAGLKVLQLINDNTAVALNYGVFRRKDINSTAQNIM 221

  Fly   197 IFDLGGGTFDVSILSI------DDGI---FEVKSTAGDTHLGGEDFDNRLVTHFVQEF--KRKHK 250
            .:|:|.|:...:|::.      :.|.   .:::....|..|||.:.:.||..|..:.|  ::|.|
Zfish   222 FYDMGSGSTTATIVTYQTVKTKESGTQPQLQIRGVGFDRTLGGFEMELRLRDHLAKLFNEQKKSK 286

  Fly   251 KDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMD 315
            ||:..|.||:.:|....:|.|..||::.:.:.:|:.|.:..||...:||:.||.|..|||.....
Zfish   287 KDVRDNLRAMAKLLKEAQRLKTVLSANAEHTAQIEGLMDDIDFKAKVTRSEFEALCEDLFDRVPG 351

  Fly   316 PVEKALRDAKLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAIL 380
            ||::||..|::....|..::||||:||:||||.:|......:||:|:||.|||.|.||..|||.|
Zfish   352 PVKQALAAAEMSMDEIEQVILVGGATRVPKVQDVLLKSVGKEELSKNINADEAAAMGAVYQAAAL 416

  Fly   381 HGDKSQEVQDLLLLDVTPLSLGIETA------GGVMS------VLIKRNTTIPTKQTQTFTTYSD 433
              .|:.:|:..|:.|.....:.:|.:      .||.|      :|.:|....|.::..||..|.|
Zfish   417 --SKAFKVKPFLVRDAAVFPIQVEFSRETEEEDGVKSLKHNKRILFQRMAPYPQRKVITFNRYID 479

  Fly   434 NQPGVLIQVYEGERAMTKDNNL-------LGKFELSGIPPA--------PRGVPQIEVTFDIDAN 483
            :   .:..:..|:.:...:.::       |...:|||:..:        .:|   |:..|::|.:
Zfish   480 D---FVFYINYGDLSFLSEQDMKVFGSQNLTTVKLSGVGSSFKKHSDAESKG---IKAHFNMDES 538

  Fly   484 GILNVTALER-----STNKENKITITNDKGRLSK-----------------EDIERMVNEAEKYR 526
            |:|.:..:|.     ...||.:.|:|.....:|.                 .|.|.:..||.|.:
Zfish   539 GVLILDRVESVFETIVEEKEEESTLTKLGNTISSLFGGGSSEPSANVTEPVTDEEEVTPEAGKEQ 603

  Fly   527 NEDEKQKETIAAK----NGLES------------YCFNM------------KATLDED------- 556
            ::.|||:||:..|    .|.|:            ...|.            :.|.||:       
Zfish   604 DQPEKQEETVQEKPETEEGKEAEPQAEEQKEDKEKAENQGETESEKTEKPEEKTTDEEKEADMKP 668

  Fly   557 --NLKTKIS-----DSDRTTILDKCNETIKWLDANQLAD-------KEEYEHRQKELEGVCNPII 607
              ..|:|||     :.:...:||...|.::. ...:|.|       |:|.|.....||.......
Zfish   669 KLQKKSKISADIAVELEVNDVLDPSAEDMEG-SKKKLQDLTDRDLEKQEREKTLNSLEAFIFETQ 732

  Fly   608 TKLYQ 612
            .||||
Zfish   733 DKLYQ 737

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 200/719 (28%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 134/390 (34%)
hyou1NP_997868.1 HSP70 27..705 CDD:278441 191/687 (28%)
HYOU1-like_NBD 28..414 CDD:212672 132/387 (34%)
PTPRCAP <598..>648 CDD:292341 12/50 (24%)
Prevents secretion from ER. {ECO:0000255} 977..980
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.