DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and Hspa12a

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:XP_017444569.1 Gene:Hspa12a RGDID:1305531 Length:691 Species:Rattus norvegicus

Alignment Length:661 Identity:143/662 (22%)
Similarity:245/662 (37%) Gaps:213/662 (32%)


  Fly     7 VGIDLGTTYS-----------CVGVFQHGKVEIIANDQG--NRTTPSYVAFTDTERL--IGDAAK 56
            |.||.|||.|           |:.|.:..:    ..|.|  |:.||:.:..|...:.  .|.||:
  Rat    75 VAIDFGTTSSGYAYSFTKEPECIHVMRRWE----GGDPGVSNQKTPTTILLTPERKFHSFGYAAR 135

  Fly    57 N-QVAMNPTQTIFDAKR-LIGRKF-------DDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKK 112
            : ...::|.    :||: |...||       .|..:.:|:       .:|:|| |::..   |..
  Rat   136 DFYHDLDPN----EAKQWLYLEKFKMKLHTTGDLTMDTDL-------TAANGK-KVKAL---EIF 185

  Fly   113 TFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGL------NVLR 171
            |:..:......|.::.:.|.:....:....||||||.:....:|..::|...|||      ..|.
  Rat   186 TYALQYFKEQALKELSDQAGSDFENSDVRWVITVPAIWKQPAKQFMREAAYQAGLASPENSEQLI 250

  Fly   172 IINEPTAAAI---------AYGLDKKAV------------------------------------- 190
            |..||.||:|         ...|..|||                                     
  Rat   251 IALEPEAASIYCRKLRLHQMIELSSKAVVNGYSASDTVGAGFAQAKEHVRRNRQSRTFLVENVIG 315

  Fly   191 --------GERNVLIFDLGGGTFDVSI--LSIDDGIFE--VKSTAGDTHLGGEDFD-NRLV---- 238
                    |::.|:: |.||||.|:::  :.:.:|..:  .|:|.|.....|.|:: .:|:    
  Rat   316 EIWSELEEGDKYVVV-DSGGGTVDLTVHQIRLPEGHLKELYKATGGPYGSLGVDYEFEKLLCKIF 379

  Fly   239 -THFVQEFKRKHKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFY-------- 294
             ..|:::||.|       ...|...|..|.|..||..:......:.|...|...|:|        
  Rat   380 GEDFIEQFKIK-------RPAAWVDLMIAFESRKRAAAPDRTNPLNITLPFSFIDYYKKFRGHSV 437

  Fly   295 ----------------TSITRARFEELNADLFRSTMDPVEKALRD--AKLDKSVIHDIVLVGGST 341
                            ..:.|...:.:|| ||:.|:|.:.:.|||  .|.:.|.:..:.||||..
  Rat   438 EHALRKSNVDFVKWSSQGMLRMSPDAMNA-LFKPTIDSIIEHLRDLFQKPEVSTVKFLFLVGGFA 501

  Fly   342 RIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAV-QAAILHGDKSQEVQDLLLLDV--TPLSLGI 403
            ..|.:|:.:|..|..|  .:.|.|.:.   |..: :.|:|.|      .|..::.|  :||:.|:
  Rat   502 EAPLLQQAVQAAFGDK--CRIIIPQDV---GLTILKGAVLFG------LDPAVIKVRRSPLTYGV 555

  Fly   404 ETAGGVMS-----------VLIKRNTT---------IPTKQT--------QTFTTYSDNQPGVLI 440
                ||::           :|:|..|.         |...|:        :::|....:|..::|
  Rat   556 ----GVLNRYVEGKHPPEKLLVKDGTRWCTDVFDKFISADQSVALGELVKRSYTPAKPSQLVIII 616

  Fly   441 QVYEGER---------AMTKDNNLLGKFELSGIP----PAPRGVPQIEVTFDIDANGILNVTALE 492
            .:|..|.         .:.|...|  :.:|:|..    ||.|.:..:....|.:    :..||::
  Rat   617 NIYSSENDDVSFITDPGVKKCGTL--RLDLTGTSGAAVPARREIQTLMQFGDTE----IKATAVD 675

  Fly   493 RSTNKENKITI 503
            .:|:|..|:.|
  Rat   676 IATSKSVKVGI 686

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 143/662 (22%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 111/495 (22%)
Hspa12aXP_017444569.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.