DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and hsp70.3

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_571472.2 Gene:hsp70.3 ZFINID:ZDB-GENE-110713-1 Length:643 Species:Danio rerio

Alignment Length:649 Identity:527/650 (81%)
Similarity:578/650 (89%) Gaps:10/650 (2%)


  Fly     3 KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTI 67
            |..|:||||||||||||||||||||||||||||||||||||||||||||||||||||||||..|:
Zfish     5 KGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTV 69

  Fly    68 FDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAE 132
            |||||||||:|||..||||||||.|:|||..||||:.|.:|.|.|||.|||||||||.||||.||
Zfish    70 FDAKRLIGRRFDDPVVQSDMKHWSFKVVSDGGKPKVAVEHKGENKTFNPEEISSMVLVKMKEIAE 134

  Fly   133 AYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLI 197
            ||||:.||||||||||||||||||||||||.||||||||||||||||||||||||....||||||
Zfish   135 AYLGQKVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGKSSERNVLI 199

  Fly   198 FDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRR 262
            |||||||||||||:|:|||||||:|||||||||||||||:|.|||:|||||||||::.|||||||
Zfish   200 FDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRMVNHFVEEFKRKHKKDISQNKRALRR 264

  Fly   263 LRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKLD 327
            |||||||||||||||:|||||||||:||.||||||||||||||.:||||.|:|||||||||||:|
Zfish   265 LRTACERAKRTLSSSSQASIEIDSLYEGIDFYTSITRARFEELCSDLFRGTLDPVEKALRDAKMD 329

  Fly   328 KSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQDLL 392
            |:.|||||||||||||||:|:||||.|||:|||||||||||||||||||||||.||.|..|||||
Zfish   330 KAQIHDIVLVGGSTRIPKIQKLLQDFFNGRELNKSINPDEAVAYGAAVQAAILMGDTSGNVQDLL 394

  Fly   393 LLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLG 457
            ||||.|||||||||||||:.||||||||||||||||||||||||||||||:||||||||||||||
Zfish   395 LLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQTFTTYSDNQPGVLIQVFEGERAMTKDNNLLG 459

  Fly   458 KFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNEA 522
            ||||:||||||||||||||||||||||||||:|.::||.|:|||||||||||||||:|||||.||
Zfish   460 KFELTGIPPAPRGVPQIEVTFDIDANGILNVSAADKSTGKQNKITITNDKGRLSKEEIERMVQEA 524

  Fly   523 EKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQLA 587
            :||:.||:.|:|.|:|||.||||.||||.::::||||.|||:.|:..:::||||.:.||:.||||
Zfish   525 DKYKAEDDLQREKISAKNSLESYAFNMKNSVEDDNLKGKISEEDKKRVIEKCNEAVSWLENNQLA 589

  Fly   588 DKEEYEHRQKELEGVCNPIITKLYQGAGFPPGGMPGGPGGMPGAAGAAGAAGAGGAGPTIEEVD 651
            |||||||:.||||.||||:|:||||      ||||.|..|    |.|.||:||...||||||||
Zfish   590 DKEEYEHQLKELEKVCNPVISKLYQ------GGMPAGGCG----AQARGASGASAQGPTIEEVD 643

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 506/609 (83%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 325/375 (87%)
hsp70.3NP_571472.2 PTZ00009 5..643 CDD:240227 526/648 (81%)
HSPA1-2_6-8-like_NBD 8..383 CDD:212675 325/375 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C281053021
eggNOG 1 0.900 E1_COG0443
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D180577at33208
OrthoFinder 1 1.000 FOG0000062
OrthoInspector 1 1.000 T128641
orthoMCL 1 0.900 OOG5_126588
Panther 1 1.100 O PTHR19375
Phylome 1 0.910 0.714 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R573
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.780

Return to query results.
Submit another query.