DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and Hspa4l

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:XP_006232359.1 Gene:Hspa4l RGDID:1306528 Length:1017 Species:Rattus norvegicus

Alignment Length:796 Identity:211/797 (26%)
Similarity:343/797 (43%) Gaps:204/797 (26%)


  Fly     7 VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAK 71
            ||||||.....:.|.:.|.:|.|||:..:|.||:.::.....|.||:|||:|:..|...||...|
  Rat   183 VGIDLGFLNCYIAVARSGGIETIANEYSDRCTPACISLGSRTRAIGNAAKSQIVTNVRNTIHGFK 247

  Fly    72 RLIGRKFDDAAVQSDMKHWPFEVVS-ADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYL 135
            :|.||.|||..||::....|:|:.. .:|...::|.|.:|::.|..|:::.|:|.|:|||:|..|
  Rat   248 KLHGRSFDDPIVQTERIRLPYELQKMPNGSAGVKVRYLEEERPFAIEQVTGMLLAKLKETSENAL 312

  Fly   136 GKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYG--------LDKKAVGE 192
            .|.|.:.||::|::|.|::|::...|..:||||.||::||.||.|:|||        ||:|   .
  Rat   313 KKPVADCVISIPSFFTDAERRSVMAAAQVAGLNCLRLMNETTAVALAYGIYKQDLPSLDEK---P 374

  Fly   193 RNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNK 257
            |||:..|:|...:.||:.:.:.|..:|.:|..|.:|||.:||..||.:|..|||.|:|.::..|.
  Rat   375 RNVVFIDMGHSAYQVSVCAFNKGKLKVLATTFDPYLGGRNFDEALVDYFCDEFKAKYKINVKENS 439

  Fly   258 RALRRLRTACERAKRTLS-SSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKAL 321
            |||.||...||:.|:.:| :::...:.|:......|..:.:.||:||:|.|.|......|::..:
  Rat   440 RALLRLYQECEKLKKLMSANASDLPLNIECFMNDLDVSSKMNRAQFEQLCASLLARVEPPLKAVM 504

  Fly   322 RDAKLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQ 386
            ..|.|.:..|:.|.:|||:||||.|:..:...|. |:::.::|.|||||.|.|:|.|||  ..:.
  Rat   505 DQANLQREDINSIEIVGGATRIPAVKEQVTRFFL-KDISTTLNADEAVARGCALQCAIL--SPAF 566

  Fly   387 EVQDLLLLDVTPLSL------GIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEG 445
            :|::..:.|:.|.|:      ..|...|...|..| |...|..:..||   ...:|..|...|..
  Rat   567 KVREFSITDLVPYSVTLSWKTSFEEGTGECEVFSK-NHPAPFSKVITF---HKKEPFELEAFYTN 627

  Fly   446 ERAMTKDNNLLGKFELSGIPPAPRG-VPQIEVTFDIDANGILNVTA------------------- 490
            ...:...:..:|.|.:..:.|...| ..:::|...|:.:||.:|.:                   
  Rat   628 LHEVPYPDPRIGNFTIQNVFPQSDGDSSKVKVKVRINIHGIFSVASASVIEKQNLEGDHNDAPME 692

  Fly   491 LERSTNK--------------------------ENKITITNDKGRLSKEDIERMVNEAEK----- 524
            .|.|.|:                          |.:|..|..|.:....|.:..:|:..|     
  Rat   693 TEASKNEGKEDVDKMQVDQEEGGHQKCHAEHTPEEEIDHTGAKAKAPPSDKQDRINQTIKKGKIK 757

  Fly   525 ----------YRN------------------EDEKQKETIAAKNGLESYCFNMKATL-------- 553
                      ||.                  :|:.:||...|||.:|.|.::.:..|        
  Rat   758 SIDLPIQSSLYRQLTQDLLNSYIENEGKMIMQDKLEKERNDAKNAVEEYVYDFRDKLGTVYEKFI 822

  Fly   554 ---DEDNLKTKISDSD-----------RTTILDKCNE---------------------------- 576
               |.:.|...:.|::           :...:||..|                            
  Rat   823 TPEDMNKLSAMLEDTENWLYEEGEDQPKQVYVDKLQELKKYGQPIQMKYVEHEERPKALNDLGKK 887

  Fly   577 ---TIKWLDANQLADKEEYEH-------------------------------------------- 594
               .:|.::|::..| |.|:|                                            
  Rat   888 IQLVLKVIEAHRNKD-ERYDHLDPAEMEKVEKYISDSMNWLNSKMNAQNKLSLTQDPVVKVSEIV 951

  Fly   595 -RQKELEGVCNPIITK 609
             :.|||:..||||:.|
  Rat   952 TKSKELDNFCNPIVYK 967

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 211/797 (26%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 146/384 (38%)
Hspa4lXP_006232359.1 HSPA4L_NBD 181..563 CDD:212688 146/386 (38%)
HSP70 182..873 CDD:278441 197/700 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.