DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and Hspa9

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001094128.2 Gene:Hspa9 RGDID:1311806 Length:679 Species:Rattus norvegicus

Alignment Length:605 Identity:320/606 (53%)
Similarity:406/606 (67%) Gaps:43/606 (7%)


  Fly     3 KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTQT 66
            |...||||||||.|||.|.:..:.:::.|.:|.|||||.|||| |.|||:|..||.|...||..|
  Rat    52 KGAVVGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTPDGERLVGMPAKRQAVTNPNNT 116

  Fly    67 IFDAKRLIGRKFDDAAVQSDMKHWPFEVVSA-DGKPKIEVTYKDEKKTFFPEEISSMVLTKMKET 130
            .:..||||||::||..||.|.|:.||::|.| :|...:|.    ..|.:.|.:|.:.||.|||||
  Rat   117 FYATKRLIGRRYDDPEVQKDTKNVPFKIVRASNGDAWVEA----HGKLYSPSQIGAFVLMKMKET 177

  Fly   131 AEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNV 195
            ||.|||.|..||||||||||||||||||||||.|:||||||:||||||||:||||||..  ::.:
  Rat   178 AENYLGHTAKNAVITVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKSE--DKVI 240

  Fly   196 LIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRAL 260
            .::||||||||:|||.|..|:||||||.|||.|||||||..|:.|.|:||||:...|||.:..||
  Rat   241 AVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDQALLRHIVKEFKRETGVDLTKDNMAL 305

  Fly   261 RRLRTACERAKRTLSSSTQASIEIDSLFEGTD----FYTSITRARFEELNADLFRSTMDPVEKAL 321
            :|:|.|.|:||..||||.|..|.:..|.....    ....:|||:||.:..||.:.|:.|.:||:
  Rat   306 QRVREAAEKAKCELSSSVQTDINLPYLTMDASGPKHLNMKLTRAQFEGIVTDLIKRTIAPCQKAM 370

  Fly   322 RDAKLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQ 386
            :||::.||.|.:::||||.||:||||:.:|||| |:..:|::|||||||.|||:|..:|.||   
  Rat   371 QDAEVSKSDIGEVILVGGMTRMPKVQQTVQDLF-GRAPSKAVNPDEAVAIGAAIQGGVLAGD--- 431

  Fly   387 EVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTK 451
             |.|:||||||||||||||.|||.:.||.||||||||::|.|:|.:|.|..|.|:|.:|||.|..
  Rat   432 -VTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVCQGEREMAG 495

  Fly   452 DNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIE 516
            ||.|||:|.|.|||||||||||||||||||||||::|:|.::.|.:|.:|.| ...|.|||:|||
  Rat   496 DNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVI-QSSGGLSKDDIE 559

  Fly   517 RMVNEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDE--DNLKTKISDSDRTTILDKCNETIK 579
            .||..||||..||.::||.:.|.|..|....:.:..::|  |.|..           |:||:.  
  Rat   560 NMVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFKDQLPA-----------DECNKL-- 611

  Fly   580 WLDANQLADKEEYEHRQKEL 599
                     |||.. :.:||
  Rat   612 ---------KEEIS-KMREL 621

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 320/606 (53%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 209/381 (55%)
Hspa9NP_001094128.2 Interaction with NFS1. {ECO:0000250|UniProtKB:P38646} 1..432 212/391 (54%)
dnaK 52..656 CDD:234715 320/606 (53%)
HSPA9-like_NBD 52..428 CDD:212683 209/383 (55%)
Interaction with FXN and ISCU. {ECO:0000250|UniProtKB:P38646} 432..679 108/215 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D288077at2759
OrthoFinder 1 1.000 FOG0000062
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.