DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and Hspa4

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_705893.1 Gene:Hspa4 RGDID:628878 Length:840 Species:Rattus norvegicus

Alignment Length:846 Identity:224/847 (26%)
Similarity:365/847 (43%) Gaps:212/847 (25%)


  Fly     7 VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAK 71
            ||||||.....|.|.:.|.:|.|||:..:|.||:.|:|....|.:|.|||:||..|...|:...|
  Rat     4 VGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACVSFGPKNRSVGAAAKSQVISNAKNTVQGFK 68

  Fly    72 RLIGRKFDDAAVQSDMKHWPFEVVS-ADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYL 135
            |..||.|.|..|:::..:..:::|. ..|...|:|||.:|::.|..|::::|:|:|:|||||:.|
  Rat    69 RFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEERNFTTEQVTAMLLSKLKETAESVL 133

  Fly   136 GKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGL---DKKAVGE--RNV 195
            .|.|.:.|::||:::.|::|::..||..|||||.||::||.||.|:|||:   |..|:.|  |||
  Rat   134 KKPVVDCVVSVPSFYTDAERRSVMDATQIAGLNCLRLMNETTAVALAYGIYKQDLPALEEKPRNV 198

  Fly   196 LIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRAL 260
            :..|:|...:.||:.:.:.|..:|.:||.||.|||..||..||.||.:||.:|:|.|:.:..|||
  Rat   199 VFVDMGHSAYQVSVCAFNRGKLKVLATAFDTTLGGRKFDEVLVNHFCEEFGKKYKLDIKSKVRAL 263

  Fly   261 RRLRTACERAKRTLS-SSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDA 324
            .||...||:.|:.:| :::...:.|:......|...::.|.:|.|:..||......|:...|..:
  Rat   264 LRLSQECEKLKKLMSANASDLPLSIECFMNDIDVSGTMNRGKFLEMCDDLLARVEPPLRSILDQS 328

  Fly   325 KLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQ 389
            ||.|..|:.:.:|||:||||.|:..:...| ||||:.::|.||||..|.|:|.|||  ..:.:|:
  Rat   329 KLKKEDIYAVEIVGGATRIPAVKEKISKFF-GKELSTTLNADEAVTRGCALQCAIL--SPAFKVR 390

  Fly   390 DLLLLDVTPLSLGIE-----TAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAM 449
            :..:.||.|..:.:.     ..|.....:..:|...|..:..||..   .:|..|...|...:.:
  Rat   391 EFSITDVVPYPISLRWNSPAEEGSSDCEVFPKNHAAPFSKVLTFYR---KEPFTLEAYYSSPQDL 452

  Fly   450 TKDNNLLGKFELSGIPPAPRG-VPQIEVTFDIDANGILNVTA---LERSTNKENKITITNDKGRL 510
            ...:..:.:|.:..:.|...| ..:::|...::.:||.:|::   :|...::|::..:..|:.  
  Rat   453 PYPDPAIAQFSVQKVTPQSDGSSSKVKVKVRVNVHGIFSVSSAALVEVHKSEESEEPMETDQN-- 515

  Fly   511 SKEDIERMVNEAEKYRNE----------------------------------------------- 528
            :||:.:..|::.|.:..|                                               
  Rat   516 AKEEEKMQVDQEEPHTEEQQPQTPAENKAESEEMETSQAGSKDKKMDQPPQAKKAKVKTSTVDLP 580

  Fly   529 ---------------------------DEKQKETIAAKNGLESYCFNMKATL-----------DE 555
                                       |:.:||...|||.:|.|.:.|:..|           |.
  Rat   581 IESQLLWQLDREMLGLYTENEGKMIMQDKLEKERNDAKNAVEEYVYEMRDKLSGEYEKFVSEDDR 645

  Fly   556 DNLKTKISD-------------------------------------------------------- 564
            :|...|:.|                                                        
  Rat   646 NNFTLKLEDTENWLYEDGEDQPKQVYVDKLAELRTLGQPIKTRFQESEERPKLFEELGKQIQQYM 710

  Fly   565 ------------------SDRTTILDKCNETIKW------------LDANQLADKEEYEHRQKEL 599
                              :|.|.:....||.::|            |.|:.:...:|.|.:.|||
  Rat   711 KVISSFKNKEDQYEHLDAADMTKVEKSTNEAMEWMNSKLNLQNKQSLTADPVVKTKEIEAKIKEL 775

  Fly   600 EGVCNPIITKLYQGAGFPP---------GGMPGGPGGMPGAAGAAGAAGAGGAGPT-----IEEV 650
            ..:|:|||:|...... ||         .|...|.|..||.  .|...||..|.|:     :.|:
  Rat   776 TNICSPIISKPKPKVE-PPKEEPKHAEQNGPVDGQGDNPGT--QAAEHGADTAVPSDGDKKLPEM 837

  Fly   651 D 651
            |
  Rat   838 D 838

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 210/792 (27%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 152/381 (40%)
Hspa4NP_705893.1 HSPA4_NBD 2..384 CDD:212687 152/383 (40%)
HSP70 3..607 CDD:278441 179/611 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.