DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and ssc1

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_593459.1 Gene:ssc1 PomBaseID:SPAC664.11 Length:674 Species:Schizosaccharomyces pombe

Alignment Length:643 Identity:309/644 (48%)
Similarity:431/644 (67%) Gaps:38/644 (6%)


  Fly     3 KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTQT 66
            |.|.:|||||||.||:.:.:....::|||.:|.|||||.|||| |.|||:|.:||.|..:||..|
pombe    49 KGPVIGIDLGTTTSCLAIMEGQTPKVIANAEGTRTTPSVVAFTKDGERLVGVSAKRQAVINPENT 113

  Fly    67 IFDAKRLIGRKFDDAAVQSDMKHWPFEVVS-ADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKET 130
            .|..||||||:|.:..||.|:|..|:::|. ::|...:|.    ..||:.|.:|...:|:||:||
pombe   114 FFATKRLIGRRFKEPEVQRDIKEVPYKIVEHSNGDAWLEA----RGKTYSPSQIGGFILSKMRET 174

  Fly   131 AEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNV 195
            |..||||.|.|||:|||||||||||||||.||.||||||||::|||||||:|||||||  .:..|
pombe   175 ASTYLGKDVKNAVVTVPAYFNDSQRQATKAAGAIAGLNVLRVVNEPTAAALAYGLDKK--NDAIV 237

  Fly   196 LIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRAL 260
            .:|||||||||:|||.:::|:|||:||.|||||||||||..||.|.|:.||:....||:.::.|:
pombe   238 AVFDLGGGTFDISILELNNGVFEVRSTNGDTHLGGEDFDVALVRHIVETFKKNEGLDLSKDRLAV 302

  Fly   261 RRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTS-----------ITRARFEELNADLFRSTM 314
            :|:|.|.|:||..|||.::..|.:       .|.|:           |:||:||:|...|.|.|:
pombe   303 QRIREAAEKAKCELSSLSKTDISL-------PFITADATGPKHINMEISRAQFEKLVDPLVRRTI 360

  Fly   315 DPVEKALRDAKLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAI 379
            ||.::||:||.|..|.|::::||||.||:|:|...::.:|. :|..||:|||||||.|||:|..:
pombe   361 DPCKRALKDANLQTSEINEVILVGGMTRMPRVVETVKSIFK-REPAKSVNPDEAVAIGAAIQGGV 424

  Fly   380 LHGDKSQEVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYE 444
            |.|    .|:||:|||||||||||||.|||.:.||.|||||||:::|.|:|.:|.|..|.|:|::
pombe   425 LSG----HVKDLVLLDVTPLSLGIETLGGVFTRLINRNTTIPTRKSQVFSTAADGQTAVEIRVFQ 485

  Fly   445 GERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGR 509
            |||.:.:||.|:|.|:|:||.|||:|.|||||:||:||:||:||:|.:::|||::.||:....| 
pombe   486 GERELVRDNKLIGNFQLTGIAPAPKGQPQIEVSFDVDADGIINVSARDKATNKDSSITVAGSSG- 549

  Fly   510 LSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLD--EDNLKTKISDSDRTTILD 572
            |:..:||.||.:|||||..|..:||.|...|..||.|.::::.||  :|.|..:..:..|:.|.|
pombe   550 LTDSEIEAMVADAEKYRASDMARKEAIENGNRAESVCTDIESNLDIHKDKLDQQAVEDLRSKITD 614

  Fly   573 KCNETIKWLDA-NQLADKEEYEHRQKELEGVCNPIITKLY--QGAGFPPGGMPGGPGG 627
             ..||:..::| ::....|:.:.:..|::.:...:...:|  |..|....|....|.|
pombe   615 -LRETVAKVNAGDEGITSEDMKKKIDEIQQLSLKVFESVYKNQNQGNESSGDNSAPEG 671

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 304/627 (48%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 199/388 (51%)
ssc1NP_593459.1 dnaK 49..671 CDD:234715 308/642 (48%)
HSPA9-like_NBD 49..425 CDD:212683 200/390 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000062
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.