DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and sks2

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_595438.1 Gene:sks2 PomBaseID:SPBC1709.05 Length:613 Species:Schizosaccharomyces pombe

Alignment Length:583 Identity:359/584 (61%)
Similarity:445/584 (76%) Gaps:4/584 (1%)


  Fly     6 AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDA 70
            |:|||||||||||.|::...||||.||||.|||||:||||:||||:|||||||.||||..|:|||
pombe     8 AIGIDLGTTYSCVAVWETANVEIIPNDQGARTTPSFVAFTETERLVGDAAKNQAAMNPRNTVFDA 72

  Fly    71 KRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYL 135
            ||||||:::|...|.|:|||||:|:..:|.|.|||.|..|||.|..:|||:||||||||.:||.|
pombe    73 KRLIGRRYEDPETQKDIKHWPFKVIDNNGIPTIEVNYLGEKKQFTAQEISAMVLTKMKEISEAKL 137

  Fly   136 GKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVLIFDL 200
            .|.|..|||||||||:||||.||||||.|||||||||||||||||||||||.|:...:|||||||
pombe   138 NKRVEKAVITVPAYFSDSQRAATKDAGAIAGLNVLRIINEPTAAAIAYGLDAKSDKPKNVLIFDL 202

  Fly   201 GGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRRLRT 265
            ||||||||:|.|..|:|||.:||||||||||||||.||.||:||||||.|.|::.:.|||||||:
pombe   203 GGGTFDVSLLKIQGGVFEVLATAGDTHLGGEDFDNALVEHFIQEFKRKQKIDISDDPRALRRLRS 267

  Fly   266 ACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKLDKSV 330
            |||||||.|||.||.::|:|||..|.||.:||||||||::||..|::|:|||.|.|:|:|:.|:.
pombe   268 ACERAKRALSSVTQTTVEVDSLSNGIDFSSSITRARFEDINATTFKATIDPVAKVLKDSKVPKAD 332

  Fly   331 IHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAIL-HGDKSQEVQDLLLL 394
            :||||||||||||||||||:.|.|:|:.||||||||||||||||||||:| :...|.:.||||||
pombe   333 VHDIVLVGGSTRIPKVQRLVSDFFDGRALNKSINPDEAVAYGAAVQAAVLTNKADSDKTQDLLLL 397

  Fly   395 DVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKF 459
            ||.|||||:...|.|..|:..|||.|||.:.:||||.:|||..|...||:|||....:|..||:|
pombe   398 DVVPLSLGVAMEGNVFGVVCPRNTPIPTIKKRTFTTVADNQTTVTFPVYQGERVNCAENEPLGEF 462

  Fly   460 ELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNEAEK 524
            :|:||||.|||..::|.||::||||||.|||:|::|.:...|.|||..|.||...|:.|:..|:|
pombe   463 QLTGIPPMPRGQAELEATFELDANGILKVTAVEKTTGRSAHIEITNSVGHLSSTKIQEMIENADK 527

  Fly   525 YRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTI---LDKCNETIKWLDAN 584
            ::.:|:...:.:.||:.||||..|::.|:.|.|:..|:...|::.|   |.:|...::..|.|
pombe   528 FKQQDKDFAKKLEAKSQLESYISNIETTISEPNVMMKLKRGDKSKIEAQLAECMSQLELEDTN 590

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 359/584 (61%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 268/376 (71%)
sks2NP_595438.1 HSP70 8..613 CDD:278441 359/584 (61%)
HSPA1-2_6-8-like_NBD 8..383 CDD:212675 268/375 (71%)
BAR <503..>603 CDD:299863 29/89 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000062
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126588
Panther 1 1.100 O PTHR19375
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.960

Return to query results.
Submit another query.