DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and Hspa1l

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_997711.1 Gene:Hspa1l RGDID:1595925 Length:641 Species:Rattus norvegicus

Alignment Length:653 Identity:521/654 (80%)
Similarity:584/654 (89%) Gaps:18/654 (3%)


  Fly     2 SKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQT 66
            :|..|:||||||||||||||||||||||||||||||||||||||||||||||||||||||||..|
  Rat     4 NKGMAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPQNT 68

  Fly    67 IFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETA 131
            :|||||||||||:|..||||||.|||:|::..||||:.|:||.|||.|:||||||||||||||||
  Rat    69 VFDAKRLIGRKFNDPVVQSDMKLWPFQVINEAGKPKVLVSYKGEKKAFYPEEISSMVLTKMKETA 133

  Fly   132 EAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVL 196
            ||:||.:||||||||||||||||||||||||.||||||||||||||||||||||||.:.|||:||
  Rat   134 EAFLGHSVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGSHGERHVL 198

  Fly   197 IFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALR 261
            ||||||||||||||:|||||||||:|||||||||||||||||:|||:|||||||||::.||||:|
  Rat   199 IFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVR 263

  Fly   262 RLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKL 326
            |||||||||||||||||||::|||||:||.||||||||||||||.|||||.|::||||:|||||:
  Rat   264 RLRTACERAKRTLSSSTQANLEIDSLYEGIDFYTSITRARFEELCADLFRGTLEPVEKSLRDAKM 328

  Fly   327 DKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQDL 391
            ||:.|||||||||||||||||:||||.|||::||||||||||||||||||||||.||||::||||
  Rat   329 DKAKIHDIVLVGGSTRIPKVQKLLQDYFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSEKVQDL 393

  Fly   392 LLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLL 456
            |||||.|||||:|||||||:||||||:||||||||.|||||||||||||||||||||||:|||||
  Rat   394 LLLDVAPLSLGLETAGGVMTVLIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTRDNNLL 458

  Fly   457 GKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNE 521
            |:|:|:||||||||||||||||||||||||||||:::||.|.|||||||||||||||:|||||.|
  Rat   459 GRFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAMDKSTGKANKITITNDKGRLSKEEIERMVQE 523

  Fly   522 AEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQL 586
            ||:|:.|||.|:|.|||||.||||.||||:.:.::.||.|||:||:..|||||:|.:.||:||||
  Rat   524 AERYKAEDEGQREKIAAKNALESYAFNMKSAVGDEGLKDKISESDKKKILDKCSEVLSWLEANQL 588

  Fly   587 ADKEEYEHRQKELEGVCNPIITKLYQGAGFPPGGMPG---GPGGMPGAAGAAGAAGAGGAGPTIE 648
            |:|||::|::||||.:||||||||||      .|..|   .||..||.|         ..|||||
  Rat   589 AEKEEFDHKRKELENMCNPIITKLYQ------SGCTGPTCAPGYTPGRA---------ATGPTIE 638

  Fly   649 EVD 651
            |||
  Rat   639 EVD 641

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 505/610 (83%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 324/375 (86%)
Hspa1lNP_997711.1 PTZ00009 3..641 CDD:240227 520/652 (80%)
Nucleotide-binding domain (NBD). {ECO:0000250|UniProtKB:P11142} 3..388 329/384 (86%)
HSPA1-2_6-8-like_NBD 8..383 CDD:212675 324/375 (86%)
Substrate-binding domain (SBD). {ECO:0000250|UniProtKB:P11142} 396..511 101/115 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D180577at33208
OrthoFinder 1 1.000 FOG0000062
OrthoInspector 1 1.000 T617706
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR19375
Phylome 1 0.910 0.714 Consistency score
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.