DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and Hspa1a

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_034609.2 Gene:Hspa1a MGIID:96244 Length:641 Species:Mus musculus

Alignment Length:651 Identity:523/652 (80%)
Similarity:583/652 (89%) Gaps:10/652 (2%)


  Fly     1 MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQ 65
            |:|..|:|||||||||||||||||||||||||||||||||||||||||||||||||||||:||..
Mouse     1 MAKNTAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQN 65

  Fly    66 TIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKET 130
            |:|||||||||||.||.||||||||||:||:...|||::|.||.|.::||||||||||||||||.
Mouse    66 TVFDAKRLIGRKFGDAVVQSDMKHWPFQVVNDGDKPKVQVNYKGESRSFFPEEISSMVLTKMKEI 130

  Fly   131 AEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNV 195
            ||||||..||||||||||||||||||||||||.|||||||||||||||||||||||:...|||||
Mouse   131 AEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNV 195

  Fly   196 LIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRAL 260
            |||||||||||||||:|||||||||:|||||||||||||||||:|||:|||||||||::.||||:
Mouse   196 LIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAV 260

  Fly   261 RRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAK 325
            |||||||||||||||||||||:||||||||.||||||||||||||.:||||.|::||||||||||
Mouse   261 RRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRGTLEPVEKALRDAK 325

  Fly   326 LDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQD 390
            :||:.|||:|||||||||||||:||||.|||::||||||||||||||||||||||.||||:.|||
Mouse   326 MDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQD 390

  Fly   391 LLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNL 455
            ||||||.|||||:|||||||:.|||||:||||||||||||||||||||||||||||||||:||||
Mouse   391 LLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTRDNNL 455

  Fly   456 LGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVN 520
            ||:||||||||||||||||||||||||||||||||.::||.|.|||||||||||||||:|||||.
Mouse   456 LGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQ 520

  Fly   521 EAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQ 585
            |||:|:.|||.|::.:||||.||||.||||:.::::.||.|:|::|:..:||||.|.|.|||:|.
Mouse   521 EAERYKAEDEVQRDRVAAKNALESYAFNMKSAVEDEGLKGKLSEADKKKVLDKCQEVISWLDSNT 585

  Fly   586 LADKEEYEHRQKELEGVCNPIITKLYQGAGFPPGGMPGGPGGMPGAAGAAGAAGAGGAGPTIEEV 650
            ||||||:.|:::|||.||:|||:.||||||.|      |.||.    ||....||.|:|||||||
Mouse   586 LADKEEFVHKREELERVCSPIISGLYQGAGAP------GAGGF----GAQAPKGASGSGPTIEEV 640

  Fly   651 D 651
            |
Mouse   641 D 641

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 502/611 (82%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 325/375 (87%)
Hspa1aNP_034609.2 PTZ00009 1..641 CDD:240227 522/650 (80%)
Nucleotide-binding domain (NBD). {ECO:0000250|UniProtKB:P11142} 2..386 330/384 (86%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 325/375 (87%)
Substrate-binding domain (SBD). {ECO:0000250|UniProtKB:P11142} 394..509 103/115 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D180577at33208
OrthoFinder 1 1.000 FOG0000062
OrthoInspector 1 1.000 T615594
orthoMCL 1 0.900 OOG5_126588
Panther 1 1.100 O PTHR19375
Phylome 1 0.910 0.714 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R573
TreeFam 00.000 Not matched by this tool.
98.850

Return to query results.
Submit another query.