DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and Hspa4l

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_035150.3 Gene:Hspa4l MGIID:107422 Length:838 Species:Mus musculus

Alignment Length:825 Identity:221/826 (27%)
Similarity:350/826 (42%) Gaps:209/826 (25%)


  Fly     7 VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAK 71
            ||||||.....:.|.:.|.:|.|||:..:|.||:.::.....|.||:|||:|:..|...||...|
Mouse     4 VGIDLGFLNCYIAVARSGGIETIANEYSDRCTPACISLGSRTRAIGNAAKSQIVTNVRNTIHGFK 68

  Fly    72 RLIGRKFDDAAVQSDMKHWPFEVVS-ADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYL 135
            :|.||.|||..||::....|:|:.. .:|...::|.|.:|::.|..|:::.|:|.|:|||:|..|
Mouse    69 KLHGRSFDDPIVQTERIRLPYELQKMPNGSTGVKVRYLEEERPFAIEQVTGMLLAKLKETSENAL 133

  Fly   136 GKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYG--------LDKKAVGE 192
            .|.|.:.||::|::|.|::|::...|..:||||.||::||.||.|:|||        ||:|   .
Mouse   134 KKPVADCVISIPSFFTDAERRSVMAAAQVAGLNCLRLMNETTAVALAYGIYKQDLPSLDEK---P 195

  Fly   193 RNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNK 257
            |||:..|:|...:.||:.:.:.|..:|.:|..|.:|||.:||..||.:|..|||.|:|.::..|.
Mouse   196 RNVVFIDMGHSAYQVSVCAFNKGKLKVLATTFDPYLGGRNFDEALVDYFCDEFKTKYKINVKENS 260

  Fly   258 RALRRLRTACERAKRTLS-SSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKAL 321
            |||.||...||:.|:.:| :::...:.|:......|..:.:.||:||:|.|.|......|::..:
Mouse   261 RALLRLYQECEKLKKLMSANASDLPLNIECFMNDLDVSSKMNRAQFEQLCASLLARVEPPLKSVM 325

  Fly   322 RDAKLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQ 386
            ..|.|.:..|:.|.:|||:||||.|:..:...|. |:::.::|.|||||.|.|:|.|||  ..:.
Mouse   326 DQANLQREDINSIEIVGGATRIPAVKEQVTRFFL-KDISTTLNADEAVARGCALQCAIL--SPAF 387

  Fly   387 EVQDLLLLDVTPLSL------GIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEG 445
            :|::..:.|:.|.|:      ..|...|...|..| |...|..:..||   ...:|..|...|..
Mouse   388 KVREFSITDLVPYSVTLRWKTSFEEGTGECEVFSK-NHPAPFSKVITF---HKKEPFELEAFYTN 448

  Fly   446 ERAMTKDNNLLGKFELSGIPPAPRG-VPQIEVTFDIDANGILNV-----------------TALE 492
            ...:...:..:|.|.:..:.|...| ..:::|...|:.:||.:|                 .|:|
Mouse   449 LHEVPYPDPRIGNFTIQNVFPQSDGDSSKVKVKVRINIHGIFSVASASVIEKQNLEGDHNDAAME 513

  Fly   493 RSTNK----------------------------ENKITITNDKGRLSKEDIERMVNEAEK----- 524
            ....|                            |.:|..|..|.:....|.:..:|:..|     
Mouse   514 TEAPKSEGKEDVDKMQVDQEEGGHQKCHAEHTPEEEIDHTGAKAKAPPSDKQDRINQTIKKGKIK 578

  Fly   525 ----------YRN------------------EDEKQKETIAAKNGLESYCFNMKATL-------- 553
                      ||.                  :|:.:||...|||.:|.|.::.:..|        
Mouse   579 SIDLPIQSSLYRQLTQDLLNSYIENEGKMIMQDKLEKERNDAKNAVEEYVYDFRDKLGTVYEKFI 643

  Fly   554 ---DEDNLKTKISDS-----------------DRTTILDKCNETI--KWLD-------ANQLADK 589
               |.:.|...:.|:                 ||...|.|..:.|  |:::       .|.|..|
Mouse   644 TPEDMNKLSAMLEDTENWLYEEGEDQPKQVYVDRLQELKKYGQPIQMKYVEHEERPKALNDLGKK 708

  Fly   590 ---------------EEYEH--------------------------------------------- 594
                           |.|:|                                             
Mouse   709 IQLVLKVIEAHRNKDERYDHLDPAEMERVEKYISDSMNWLNSKMNAQNKLSLTQDPVVKVSEIVT 773

  Fly   595 RQKELEGVCNPIITKLYQGAGFP-----PGGMPGGPGGMPGAAGA 634
            :.|||:..||||:.|.......|     .|....||  |.|.:|:
Mouse   774 KSKELDNFCNPIVYKPKPKVEAPEDKAKTGSEHNGP--MDGQSGS 816

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 214/797 (27%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 146/384 (38%)
Hspa4lNP_035150.3 HSPA4L_NBD 2..384 CDD:212688 146/386 (38%)
HSP70 3..694 CDD:278441 200/700 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.