DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and T14G8.3

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001024913.1 Gene:T14G8.3 WormBaseID:WBGene00011771 Length:921 Species:Caenorhabditis elegans

Alignment Length:683 Identity:194/684 (28%)
Similarity:330/684 (48%) Gaps:98/684 (14%)


  Fly     6 AVGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFD 69
            |:.||||:.:..:|:.:.| .::|:.|.:..|.||:.::|.:.||...:||....:.:|..:...
 Worm    28 AMSIDLGSQFIKIGLVKPGVPMDIVLNKESRRKTPNVISFKNDERFFAEAAAAMSSSHPQSSYNF 92

  Fly    70 AKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEV-TYKDEKKTFFPEEISSMVLTKMKETAEA 133
            ...:|.||..|.|..:..|.:||.....|...|..| .||:||  :..|.:.:|:|...|:..||
 Worm    93 LLSMIARKEGDDAFVTFQKTFPFTAFEFDEVRKTVVFPYKEEK--YNVETLLAMILWNAKKVTEA 155

  Fly   134 YLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGL-DKKAVGER--NV 195
            |..:||.:.|||||.:.|.::|:|...|..|||||:|:::|:.:|||:.||: .:|.:.|:  ::
 Worm   156 YADQTVKDVVITVPIFLNQAERRAIASAAEIAGLNLLQLLNDGSAAALNYGVFRRKEITEKPTHM 220

  Fly   196 LIFDLGGGTFDVSILSI------DDGIFEVKS--TAG---DTHLGGEDFDNRLVTHFVQEFKR-- 247
            ||:|:|......:|:..      .||..:..:  |.|   |..|||.:..|||..|..:.|:.  
 Worm   221 LIYDMGAVKTTATIVQYVLESTRKDGKDKQPTLRTVGVGFDKTLGGLEITNRLRDHLEKVFRDTV 285

  Fly   248 KHKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRS 312
            |..||::||.||:.:|....||.|:.||::.....:::||||..:|...:||...|::..||...
 Worm   286 KTSKDISTNARAIGKLHKEAERVKQVLSANKDTYAQVESLFEEQNFRAKVTREELEKMIEDLEPR 350

  Fly   313 TMDPVEKALRDAKLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQA 377
            ...|:..|:..|::..:.|..:||:|..||:|||:.:|:.:...||::..:|.|||:|.||..||
 Worm   351 IAAPILDAIGMAQISTNDIDLVVLMGAGTRVPKVKEILKTILKDKEISNFLNTDEAIAMGAVYQA 415

  Fly   378 AILHGDKSQE-----VQDLLLLDVTPLSLGIETAGGVMSVLIK----RNTTIPTKQTQTFTTYSD 433
            |  |..||.:     |.:.:|..|. ::...:|..|.|..:.|    .|..:|.: ...|::|||
 Worm   416 A--HLSKSFKVLPFNVHEKILYPVF-VNFLTKTEEGTMKPIRKSLFGENYPVPNR-VMHFSSYSD 476

  Fly   434 NQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPA-----------PRGVPQIEVTFDIDANGILN 487
            :   ..|.:.:.      |.|.|...|:||:..|           .:||   :.||.||.:||::
 Worm   477 D---FKIDIQDA------DKNPLSTVEISGVKDAIEKEVTDENSVLKGV---KTTFSIDLSGIVS 529

  Fly   488 V----TALERSTNKENKITITNDKGRLSKEDIERMVNEAEKYRNEDEKQKETIAAKNGLESYCFN 548
            |    ..:|:....|.|     ||..:.|::.:....|.|:.:.:::.:|:....|...|.....
 Worm   530 VEKASVVVEKVPTPEEK-----DKYEVDKKEFDEWEKEQEELKKKEKAEKKEKEEKKKTEGEEEK 589

  Fly   549 MKATLDEDNLKTKISDSDRTTILDKCNE------------TIKW-----LDANQ---------LA 587
            .:....|:..:.|..:.::..::.|...            |||.     :|.|:         |.
 Worm   590 NEDAAGEEKTEEKTEEVEKPVVVKKTKPVEPKAKKINVALTIKETKTDNIDLNEEEVTAAKKVLG 654

  Fly   588 D---KEEYEHRQKE----LEGVCNPIITKLYQG 613
            |   ||:.:|.::|    |||:...:..:|..|
 Worm   655 DFEQKEKEKHDREEAMNRLEGLLYDLAVRLEDG 687

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 193/681 (28%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 131/393 (33%)
T14G8.3NP_001024913.1 HYOU1-like_NBD 29..416 CDD:212672 129/389 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.