DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and hsp-6

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_504291.1 Gene:hsp-6 WormBaseID:WBGene00002010 Length:657 Species:Caenorhabditis elegans

Alignment Length:632 Identity:325/633 (51%)
Similarity:424/633 (67%) Gaps:51/633 (8%)


  Fly     3 KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPTQT 66
            |...:|||||||.|||.:.:....::|.|.:|.|||||.|||| |.|||:|..||.|...|...|
 Worm    30 KGHVIGIDLGTTNSCVSIMEGKTPKVIENAEGVRTTPSTVAFTADGERLVGAPAKRQAVTNSANT 94

  Fly    67 IFDAKRLIGRKFDDAAVQSDMKHWPFEVVSA-DGKPKIEVTYKDEKKTFFPEEISSMVLTKMKET 130
            :|..||||||:::|..||.|:|..|:::|.| :|...:|.    :.|.:.|.::.:.||.|||||
 Worm    95 LFATKRLIGRRYEDPEVQKDLKVVPYKIVKASNGDAWVEA----QGKVYSPSQVGAFVLMKMKET 155

  Fly   131 AEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNV 195
            ||:|||.||.|||:||||||||||||||||||.|:||||||:||||||||:||||||.| |::.:
 Worm   156 AESYLGTTVNNAVVTVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKDA-GDKII 219

  Fly   196 LIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRAL 260
            .::||||||||||||.|..|:||||||.|||.|||||||:.||.|.|.|||::...|||.:.:|:
 Worm   220 AVYDLGGGTFDVSILEIQKGVFEVKSTNGDTFLGGEDFDHALVHHLVGEFKKEQGVDLTKDPQAM 284

  Fly   261 RRLRTACERAKRTLSSSTQASIEIDSLFEGTD----FYTSITRARFEELNADLFRSTMDPVEKAL 321
            :|||.|.|:||..|||:||..|.:..:.....    ....:|||:||::..||.:.|::|..|||
 Worm   285 QRLREAAEKAKCELSSTTQTDINLPYITMDQSGPKHLNLKLTRAKFEQIVGDLIKRTIEPCRKAL 349

  Fly   322 RDAKLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQ 386
            .||::..|.|.|::||||.:|:||||..:|::| ||..:|::|||||||.|||:|.|:|.||   
 Worm   350 HDAEVKSSQIADVLLVGGMSRMPKVQATVQEIF-GKVPSKAVNPDEAVAMGAAIQGAVLAGD--- 410

  Fly   387 EVQDLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTK 451
             |.|:||||||||||||||.||:|:.||.||||||||::|.|:|.:|.|..|.|:|::|||.|..
 Worm   411 -VTDVLLLDVTPLSLGIETLGGIMTKLITRNTTIPTKKSQVFSTAADGQTQVQIKVFQGEREMAT 474

  Fly   452 DNNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIE 516
            .|.|||:|.|.|||||||||||:|||||||||||:||:|.:|.|.||.:|.| ...|.|||:.||
 Worm   475 SNKLLGQFSLVGIPPAPRGVPQVEVTFDIDANGIVNVSARDRGTGKEQQIVI-QSSGGLSKDQIE 538

  Fly   517 RMVNEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDE----------DNLKTKISDSDRTTIL 571
            .|:.||||...||.|:||.:...|..|....:.:|.:.|          :.|:|||:|:.:  ||
 Worm   539 NMIKEAEKNAAEDAKRKELVEVINQAEGIIHDTEAKMTEFADQLPKDECEALRTKIADTKK--IL 601

  Fly   572 D-KCNETIKWLDANQLADKEEYEHRQKELEGVCNPI---ITKLYQGA 614
            | |.|||                  .:.::..||.:   ..||::.|
 Worm   602 DNKDNET------------------PEAIKEACNTLQQQSLKLFEAA 630

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 324/629 (52%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 207/381 (54%)
hsp-6NP_504291.1 dnaK 30..646 CDD:234715 325/633 (51%)
HSPA9-like_NBD 30..407 CDD:212683 207/383 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D288077at2759
OrthoFinder 1 1.000 FOG0000062
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.