DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and stc-1

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_495808.2 Gene:stc-1 WormBaseID:WBGene00006059 Length:450 Species:Caenorhabditis elegans

Alignment Length:381 Identity:154/382 (40%)
Similarity:230/382 (60%) Gaps:10/382 (3%)


  Fly     8 GIDLGTTYSCVGVFQ--HGKVEIIANDQGNRTTPSYVAFTDTER-LIGDAAKNQVAMNPTQTIFD 69
            |||||||||.:|::.  .|:..|:.:|.|.::.||.|||..... |||..|..|...||.:||:|
 Worm    37 GIDLGTTYSSIGIYHAVTGETIILPDDLGKKSVPSVVAFLPNGTVLIGTRATEQQEHNPKRTIYD 101

  Fly    70 AKRLIGRKFD--DAAVQSDMKHWPFEV-VSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETA 131
            |||.|||.|:  :....||.|.:||:: :.::||...|:......|..:||||.|:::..:|..|
 Worm   102 AKRFIGRNFEKNNKDFLSDQKRYPFKINLDSEGKAFFEIPLDSGTKNVYPEEIGSLIIGYLKSAA 166

  Fly   132 EAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVL 196
            ..:||.|:...||:.||.||:.||..|..|..||.:.|.|:|:||||||:||||.||. |..||:
 Worm   167 AKHLGVTLGQVVISCPAEFNEKQRNFTAKAAEIAEMEVRRVISEPTAAALAYGLHKKQ-GVENVV 230

  Fly   197 IFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALR 261
            :.||||||.|||:|.:..|:|..::.||:..|||:||::|:..|.:.:...|..|.: .||..::
 Worm   231 VVDLGGGTLDVSVLWLQGGVFVTQAMAGNNRLGGQDFNDRVQKHLISKIAEKFGKTI-DNKEDIQ 294

  Fly   262 RLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKL 326
            ::|...|:.|..|::....:|.::....|...| .:||..||.||.||.::...|:..||.||.|
 Worm   295 QIRMEVEKGKIRLTNVPSTTISLNLKTVGKWNY-ELTRDEFETLNGDLLKAIELPITAALADANL 358

  Fly   327 DKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHG 382
            |.:.:.:||||||||::|.|::::...|. |..|..::|:.||..||:|||.::.|
 Worm   359 DTADVDEIVLVGGSTQVPAVRKIVGRFFK-KSANYGVDPELAVVTGASVQAGVIGG 413

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 154/382 (40%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 153/379 (40%)
stc-1NP_495808.2 HSPA13-like_NBD 13..427 CDD:212679 154/382 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D288077at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.