DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and hsp-70

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_492485.1 Gene:hsp-70 WormBaseID:WBGene00002026 Length:643 Species:Caenorhabditis elegans

Alignment Length:664 Identity:431/665 (65%)
Similarity:527/665 (79%) Gaps:34/665 (5%)


  Fly     1 MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQ 65
            ||...|:||||||||||||::|:|||||:||.:||:||||||||||||||:|||||:|.|.||..
 Worm     1 MSTCKAIGIDLGTTYSCVGIYQNGKVEILANSEGNKTTPSYVAFTDTERLVGDAAKDQAARNPEN 65

  Fly    66 TIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKET 130
            |:|||||||||:||:..||||:|||||.|....|||.:||..|.||:.|..||||:|||.|||||
 Worm    66 TVFDAKRLIGRRFDEETVQSDIKHWPFTVKGKQGKPVVEVEVKGEKREFNAEEISAMVLQKMKET 130

  Fly   131 AEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNV 195
            |||.||.:|.:||||||||||||||||||||.||||||.:||||||||||:||||||....|:|:
 Worm   131 AEAVLGHSVRDAVITVPAYFNDSQRQATKDAATIAGLNAIRIINEPTAAALAYGLDKGITDEKNI 195

  Fly   196 LIFDLGGGTFDVSILSIDDG-IFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRA 259
            |||||||||||||||||.:| |||||||||||||||||||:|::.||:.|||||..||:::|.||
 Worm   196 LIFDLGGGTFDVSILSIAEGSIFEVKSTAGDTHLGGEDFDSRVLQHFMTEFKRKTGKDISSNPRA 260

  Fly   260 LRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDA 324
            :||||||||||||||||||:|::|:||||:|||||:.|||||||||.|||||.|::|||||||||
 Worm   261 IRRLRTACERAKRTLSSSTEATVEVDSLFDGTDFYSKITRARFEELCADLFRKTLEPVEKALRDA 325

  Fly   325 KLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQ 389
            |.||..|.::|||||||||||:|:||::.||||:||.|||||||||:|||||||:|.|.|...::
 Worm   326 KTDKGRIDEVVLVGGSTRIPKIQKLLKEFFNGKDLNCSINPDEAVAFGAAVQAAVLSGVKDDTIK 390

  Fly   390 DLLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNN 454
            |:||:||.|||.|||||||||:.||.|||.||.|.::|||||:||||||.|||||||||||:||:
 Worm   391 DVLLVDVVPLSHGIETAGGVMTNLIDRNTRIPAKASKTFTTYADNQPGVSIQVYEGERAMTRDNH 455

  Fly   455 LLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMV 519
            .||.|||:|||||||||||::|||||||||||||:|.::||.:.|:|||.|:|||||:.||:|||
 Worm   456 RLGTFELTGIPPAPRGVPQVDVTFDIDANGILNVSAADKSTGRSNRITIRNEKGRLSQADIDRMV 520

  Fly   520 NEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDAN 584
            |||:::..||..|::.|:::|.||:|.|.:|..|:|........|:.|..  |...:|::|::.|
 Worm   521 NEAKQFEREDAAQRDRISSRNQLEAYAFQVKQALEEHGSLLSAEDAKRAK--DAVEDTLRWMERN 583

  Fly   585 QLADKEEYEHRQKELEGVCNPIITKLYQ-----GAGFPPGGMPGGPGGMPGAAGAAGAAGAGG-- 642
            .||||:|.|.:.|||:.:|..|:||::|     |:|                   .|..|:||  
 Worm   584 TLADKDEIEAKDKELKSICQDILTKMHQQEAQSGSG-------------------CGNPGSGGFH 629

  Fly   643 -----AGPTIEEVD 651
                 .|||:||||
 Worm   630 SSNYPQGPTVEEVD 643

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 417/612 (68%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 283/376 (75%)
hsp-70NP_492485.1 PTZ00009 1..643 CDD:240227 430/663 (65%)
HSPA1-2_6-8-like_NBD 6..382 CDD:212675 283/376 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D180577at33208
OrthoFinder 1 1.000 FOG0000062
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126588
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.