DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and HYOU1

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:XP_005271449.1 Gene:HYOU1 HGNCID:16931 Length:1000 Species:Homo sapiens

Alignment Length:698 Identity:190/699 (27%)
Similarity:320/699 (46%) Gaps:127/699 (18%)


  Fly     7 VGIDLGTTYSCVGVFQHG-KVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDA 70
            :.:|||:....|.:.:.| .:||:.|.:..|.||..|...:.||..||:|.:....||..|:...
Human    36 MSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNPKATLRYF 100

  Fly    71 KRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKT----------FFPEEISSMVLT 125
            :.|:|::.|:          |...:.....|:.|:|:..:::|          |.|||:..|||.
Human   101 QHLLGKQADN----------PHVALYQARFPEHELTFDPQRQTVHFQISSQLQFSPEEVLGMVLN 155

  Fly   126 KMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKA- 189
            ..:..||.:..:.:.:||||||.:||.::|:|...|..:|||.||::||:.||.|::||:.::. 
Human   156 YSRSLAEDFAEQPIKDAVITVPVFFNQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFRRKD 220

  Fly   190 --VGERNVLIFDLGGGTFDVSILSI------DDGI---FEVKSTAGDTHLGGEDFD----NRLVT 239
              ...:|::.:|:|.|:...:|::.      :.|:   .:::....|..|||.:.:    .||..
Human   221 INTTAQNIMFYDMGSGSTVCTIVTYQMVKTKEAGMQPQLQIRGVGFDRTLGGLEMELRLRERLAG 285

  Fly   240 HFVQEFKRKHKKDLTTNKRALRRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEE 304
            .|.::.|.:..||:..|.||:.:|.....|.|..||::.....:|:.|.:..||...:||..|||
Human   286 LFNEQRKGQRAKDVRENPRAMAKLLREANRLKTVLSANADHMAQIEGLMDDVDFKAKVTRVEFEE 350

  Fly   305 LNADLFRSTMDPVEKALRDAKLDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAV 369
            |.||||.....||::||:.|::....|..::||||:||:|:||.:|......:||.|:||.|||.
Human   351 LCADLFERVPGPVQQALQSAEMSLDEIEQVILVGGATRVPRVQEVLLKAVGKEELGKNINADEAA 415

  Fly   370 AYGAAVQAAILHGDKSQEVQDLLLLD--VTPL----SLGIETAGGVMS------VLIKRNTTIPT 422
            |.||..|||.|  .|:.:|:..::.|  |.|:    :..:|...|:.|      ||..|....|.
Human   416 AMGAVYQAAAL--SKAFKVKPFVVRDAVVYPILVEFTREVEEEPGIHSLKHNKRVLFSRMGPYPQ 478

  Fly   423 KQTQTFTTYSDN--------QPGVL----IQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQ-- 473
            ::..||..||.:        ..|.|    ::|:..:...|        .:|.|:..:.:..|.  
Human   479 RKVITFNRYSHDFNFHINYGDLGFLGPEDLRVFGSQNLTT--------VKLKGVGDSFKKYPDYE 535

  Fly   474 ---IEVTFDIDANGILNV--------TALERSTNKENKIT-ITNDKGRL--------SKEDIERM 518
               |:..|::|.:|:|::        |.:|.|..:|:.:| :.|....|        :||:....
Human   536 SKGIKAHFNLDESGVLSLDRVESVFETLVEDSAEEESTLTKLGNTISSLFGGGTTPDAKENGTDT 600

  Fly   519 VNEAEKYRNEDEKQK--ETIAAKNGLESYCFNMKATLDEDNLKTKISD--SDRTTILDKCNETIK 579
            |.|.|:...|..|.:  |.:..|...|:..        ||..:....:  .|.|...:|..|   
Human   601 VQEEEESPAEGSKDEPGEQVELKEEAEAPV--------EDGSQPPPPEPKGDATPEGEKATE--- 654

  Fly   580 WLDANQLADKEEYEHRQKELEGVCNPIITKLYQGAGFPPGGMPGGPGG 627
                .:..||.|.:...::.|             ||  |.|:...|.|
Human   655 ----KENGDKSEAQKPSEKAE-------------AG--PEGVAPAPEG 683

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 184/682 (27%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 129/401 (32%)
HYOU1XP_005271449.1 HSP70 35..672 CDD:278441 184/684 (27%)
NBD_sugar-kinase_HSP70_actin 36..424 CDD:302596 127/398 (32%)
PHA00666 601..>739 CDD:222808 24/114 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.