DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and LOC100912578

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:XP_003749550.1 Gene:LOC100912578 RGDID:6486342 Length:119 Species:Rattus norvegicus

Alignment Length:84 Identity:24/85 (28%)
Similarity:35/85 (41%) Gaps:25/85 (29%)


  Fly   518 MVNEAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDE--DNLKTKISDSDRTTILDKCNETIKW 580
            ||..||||..||.::||.:.|.|..|....:.:..::|  |.|..           |:||:.   
  Rat     1 MVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFKDQLPA-----------DECNKL--- 51

  Fly   581 LDANQLADKEEYEHRQKEL 599
                    |||.. :.:||
  Rat    52 --------KEEIS-KMREL 61

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 24/85 (28%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675
LOC100912578XP_003749550.1 dnaK <1..113 CDD:234715 24/85 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D288077at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.