DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and hspa1a

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:XP_012823021.1 Gene:hspa1a XenbaseID:XB-GENE-5842877 Length:648 Species:Xenopus tropicalis

Alignment Length:652 Identity:546/653 (84%)
Similarity:599/653 (92%) Gaps:5/653 (1%)


  Fly     1 MSKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQ 65
            |||.||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||.
 Frog     1 MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTN 65

  Fly    66 TIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKET 130
            |:|||||||||:|||..||||||||||.|::..|:||::|.||.|.|||:.||:||||||||||.
 Frog    66 TVFDAKRLIGRRFDDPVVQSDMKHWPFTVINDGGRPKVQVEYKGEAKTFYAEEVSSMVLTKMKEI 130

  Fly   131 AEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNV 195
            :|||||||:|||||||||||||||||||||||||:|||||||||||||||||||||||..|||||
 Frog   131 SEAYLGKTITNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGGERNV 195

  Fly   196 LIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRAL 260
            |||||||||||||||:|:|||||||||||||||||||||||:|.|||.|||||||||:|.||||:
 Frog   196 LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFVGEFKRKHKKDITENKRAI 260

  Fly   261 RRLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAK 325
            |||||||||||||||||||||||||||:||.|||||:||||||||||||||.|::||||||||||
 Frog   261 RRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSLTRARFEELNADLFRGTLEPVEKALRDAK 325

  Fly   326 LDKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQD 390
            :||:.|||||||||||||||:|:||||.|||:|||||||||||||||||||||||.||||:.|||
 Frog   326 MDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGRELNKSINPDEAVAYGAAVQAAILSGDKSENVQD 390

  Fly   391 LLLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNL 455
            ||||||||||||||||||||:|||||||||||||||||||||||||||||||:||||||||||||
 Frog   391 LLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVFEGERAMTKDNNL 455

  Fly   456 LGKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVN 520
            ||||||:|||||||||||||||||||||||:||:|:::||.|||||||||||||||||:|||||.
 Frog   456 LGKFELTGIPPAPRGVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEEIERMVQ 520

  Fly   521 EAEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQ 585
            ||::|:.|||.|:|.|:|||.|||..||||:|::::.||.|||..|:..|||||||.|.|||.||
 Frog   521 EADRYKAEDEVQREKISAKNSLESLAFNMKSTVEDEKLKDKISPEDKQKILDKCNEVISWLDRNQ 585

  Fly   586 LADKEEYEHRQKELEGVCNPIITKLYQGAGFPPGGMPGG-PGGMPGAAGAAGAAGAGGAGPTIEE 649
            :|:||||||:||||:.:|||||||||||||  ..||||| |||.|||  .|||.|.|.:||||||
 Frog   586 MAEKEEYEHQQKELQNLCNPIITKLYQGAG--GAGMPGGMPGGFPGA--GAGAGGGGSSGPTIEE 646

  Fly   650 VD 651
            ||
 Frog   647 VD 648

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 518/611 (85%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 329/375 (88%)
hspa1aXP_012823021.1 PTZ00009 1..612 CDD:240227 518/611 (85%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 329/375 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0443
Hieranoid 1 1.000
Homologene 1 1.000 H136446
Inparanoid 1 1.050 1105 1.000 Inparanoid score I211
OMA 1 1.010
OrthoDB 1 1.010 D180577at33208
OrthoFinder 1 1.000 FOG0000062
OrthoInspector 1 1.000 T600681
Phylome 1 0.910 0.941 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.880

Return to query results.
Submit another query.