DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsc70-4 and hspa1b

Sequence 1:NP_001262586.1 Gene:Hsc70-4 FlyBaseID:FBgn0266599 Length:651 Species:Drosophila melanogaster
Sequence 2:XP_002937685.1 Gene:hspa1b XenbaseID:XB-GENE-5915622 Length:639 Species:Xenopus tropicalis

Alignment Length:650 Identity:534/650 (82%)
Similarity:586/650 (90%) Gaps:13/650 (2%)


  Fly     2 SKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQT 66
            ||..|:|||||||||||||||||||||||||||||||||||||||||||||||||||||:||..|
 Frog     3 SKGVAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPHNT 67

  Fly    67 IFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADGKPKIEVTYKDEKKTFFPEEISSMVLTKMKETA 131
            :||||||||||:|:..||||||||||:|:|..||||:.|.||.|.|:|.||||||||||||||||
 Frog    68 VFDAKRLIGRKYDEPVVQSDMKHWPFKVISDGGKPKVTVEYKGEGKSFSPEEISSMVLTKMKETA 132

  Fly   132 EAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKAVGERNVL 196
            |||||..||||||||||||||||||||||||.||||||||||||||||||||||||...||||:|
 Frog   133 EAYLGYKVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKSGRGERNIL 197

  Fly   197 IFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALR 261
            ||||||||||||||:|||||||||:|||||||||||||||:|.|||:|||||||||::.||||||
 Frog   198 IFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRMVNHFVEEFKRKHKKDISPNKRALR 262

  Fly   262 RLRTACERAKRTLSSSTQASIEIDSLFEGTDFYTSITRARFEELNADLFRSTMDPVEKALRDAKL 326
            |||||||||||||||||||||||||||||.||||||||||||||.|||||.|::|||||:|||||
 Frog   263 RLRTACERAKRTLSSSTQASIEIDSLFEGIDFYTSITRARFEELCADLFRGTLEPVEKAMRDAKL 327

  Fly   327 DKSVIHDIVLVGGSTRIPKVQRLLQDLFNGKELNKSINPDEAVAYGAAVQAAILHGDKSQEVQDL 391
            |||.||:||||||||||||||:||||.|||||||||||||||||||||||||||.||||:.||||
 Frog   328 DKSQIHEIVLVGGSTRIPKVQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILMGDKSENVQDL 392

  Fly   392 LLLDVTPLSLGIETAGGVMSVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLL 456
            |||||.|||||:|||||||:|||||||||||||||||||||||||||||||||||||||||||||
 Frog   393 LLLDVAPLSLGLETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLL 457

  Fly   457 GKFELSGIPPAPRGVPQIEVTFDIDANGILNVTALERSTNKENKITITNDKGRLSKEDIERMVNE 521
            |||:|:||||||||||||||||||||||||||:|:::|:.|:|||||||||||||||:||||:.|
 Frog   458 GKFDLTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSSGKQNKITITNDKGRLSKEEIERMLQE 522

  Fly   522 AEKYRNEDEKQKETIAAKNGLESYCFNMKATLDEDNLKTKISDSDRTTILDKCNETIKWLDANQL 586
            |:||:.:||:|:|.|||||.||||.||||:|::::|:|.||||:|:.:|||||.|.|.||:.|||
 Frog   523 ADKYKADDEQQREKIAAKNSLESYAFNMKSTVEDNNIKDKISDNDKKSILDKCQEVISWLEQNQL 587

  Fly   587 ADKEEYEHRQKELEGVCNPIITKLYQGAGFPPGGMPGGPGGMPGAAGAAGAAGAGGAGPTIEEVD 651
            |:||||.|:|||||.:|||||||||||         |.||||||    ||.......||||||||
 Frog   588 AEKEEYTHKQKELEKLCNPIITKLYQG---------GMPGGMPG----AGCTAEPKQGPTIEEVD 639

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsc70-4NP_001262586.1 PTZ00009 1..612 CDD:240227 515/610 (84%)
HSPA1-2_6-8-like_NBD 6..381 CDD:212675 330/375 (88%)
hspa1bXP_002937685.1 PTZ00009 2..639 CDD:240227 533/649 (82%)
HSPA1-2_6-8-like_NBD 7..382 CDD:212675 330/375 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C281041857
eggNOG 1 0.900 E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D180577at33208
OrthoFinder 1 1.000 FOG0000062
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.714 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.