DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SIDL and TRS130

Sequence 1:NP_650431.1 Gene:SIDL FlyBaseID:FBgn0038303 Length:1145 Species:Drosophila melanogaster
Sequence 2:NP_013945.1 Gene:TRS130 SGDID:S000004831 Length:1102 Species:Saccharomyces cerevisiae

Alignment Length:1345 Identity:236/1346 (18%)
Similarity:421/1346 (31%) Gaps:494/1346 (37%)


  Fly     9 YSGSCP--------LFRSLESQILNAIPLDTCEWRRTFQRPTKHVRLEAQAQQFNVAALEKYKQG 65
            |.||.|        ||.||..:....:|||...|:          ..:...:..|...:|...:|
Yeast     6 YCGSVPVSYFDPFDLFESLRPEFQQILPLDNIHWK----------AFDGTVRTVNRLPIELIPEG 60

  Fly    66 ----DWSILEHPILHIFVTECNDVDTYKATIREAIDIWLKTLTSYGVSDW-------MILLV--- 116
                |.|..|.|.:...:..|..:|.|:|.:|..:..||..|.|...|..       :|||.   
Yeast    61 RGEADKSNDEQPFIRFLIVNCISIDQYRAKVRPLVRQWLPNLESVSSSTGEKMIYKPIILLYANS 125

  Fly   117 ETLDMRKTKNFMPRTTVLDKIRLDFGTKNDDRCISVLNPAKFEQKSTESFRCLVQRIRFLMLTSY 181
            |.:|    .|.....::::|...||.........||....|..|:....|.   |:|:..:|:.:
Yeast   126 EVVD----SNLFKSVSLMEKFGKDFPHVQTLEVRSVYRSPKERQEFWNQFS---QKIKASVLSIF 183

  Fly   182 NRNIVKYEELIRSKREKRNIEG--------WDFRQYFFMQEDLALIFE----------------K 222
            .:.:...:..:.:.::..|.|.        ::....|.:.||.:|..:                |
Yeast   184 QKRLTHLQHSLANLQKGNNFEEQLLTREKLYELYVVFNILEDASLELQKIKKEILRRNMNMPDGK 248

  Fly   223 LELPTEALIQYDE------LDAMFSQFITHTGLNEKQQWLNHFR------KPLDAFHGIC----- 270
            |::|.|:..:.||      ::....:|..|     |..::...|      :.|.||.|..     
Yeast   249 LQVPFESSSKSDESLGSIIIEGTLDKFQLH-----KYFFIRRLRLLKLEDQTLTAFVGAFQLIKN 308

  Fly   271 LTRADKFEMRNKIRDEGVSLLEFRNYLFERQAYLLLTCNDIPEIAKRLLNFLFSTLREVELIKLE 335
            ...:...|.|..:|     ||||::|.                |...|..|.|..:         
Yeast   309 FIESISIEYRKSVR-----LLEFKHYF----------------ITSMLSYFEFENV--------- 343

  Fly   336 CQEGALCCWEFVCALEVLQLCEQAMEPNELTCFQHCAPIWNLAKDKLYELGKLCGLLPGCTPTSE 400
                                      .|.|.| :..|.:..|.:|...:                
Yeast   344 --------------------------SNPLLC-EIKAELLMLKRDNWVQ---------------- 365

  Fly   401 QLHIVVQLSSGIGDAPSEQHQFLQATPQLRDRSPNRKPKKSGAEQLKEALGSNQAFQKLYLELAE 465
                .|..:||.               :|.|::......|...:.|||.......||:.:|.|.:
Yeast   366 ----GVMATSGY---------------RLMDKNYPNSDVKYKFDLLKETFVDETVFQENFLTLTK 411

  Fly   466 LAISTYKHV--TRLRSARLVGLDLGNFYCALNEPHKAVGFFTDLLRELKAENWHMLSSQTLL--- 525
            ..:|.:...  .|.|...::.:::|..|....:..:||..|..........||:.:..:.|.   
Yeast   412 EILSLFNKCEGKRQRIVDILSIEIGLLYYQGKKYEEAVSLFLSCYEYYTQTNWNSIGLKILQVFI 476

  Fly   526 -ELANCYRKM------GDSLAYTKTCSS-----ISCCAE-------------------------- 552
             .|::| .|:      |:|::.:...::     :..|.:                          
Yeast   477 DSLSHC-PKLDVLQIDGESVSASAVLTNAFLNILKLCKDNDSKEIWWKKFMDLQMKNNIHLMYPL 540

  Fly   553 ---------------------LETLVRTFYFDEFLKSLKTLKTTL----------SAQPSI--EN 584
                                 :|..::::.|.|.: |.||::.:|          .|...:  :.
Yeast   541 DGLFEVTLNSKVHLARANVSAIEVNLKSYGFPEDI-STKTMRLSLKNMGGDVIVFGASDFLLKKG 604

  Fly   585 ANYCVLE------DHFRILDIEV-------VNQKPIIQDDYILVQLKVESLYPRGVVAENVKLC- 635
            .|..:||      ..|.:|..|:       |.:.|..||::|:|        |.....|:.|:. 
Yeast   605 ENKLILECRDIMYGEFSLLSFEIIVEGITFVKEFPENQDEFIVV--------PEIYCKESTKVLV 661

  Fly   636 ----------YELEASSLEL-----------------AMENVSLTASPSTVKAKDTSSRLKVSLQ 673
                      |.||..|::.                 .|:|:.::.|...::|:...:....:::
Yeast   662 KQAHNLNLGEYALELKSVQSDALESLQVEVEVQKNIGNMKNLPVSFSMDEIQARKRYNTPFENVR 726

  Fly   674 LVYKQDNRLHSAAVACDLPKSKQPVRRTSSTKRKLSPSVQADFTNFVQAENIALQPGVNLIEMKA 738
            |.|    .|.....|.||      :.:||.||:    :.|..|.                   :.
Yeast   727 LEY----YLLDQITAFDL------IIKTSFTKK----NDQGTFG-------------------ET 758

  Fly   739 KATRVGCWQFKQLCISMSSLEFLSEQLPFMPATFEISTKPASATLEFKTLIAGIVQPISLNVSG- 802
            |..|:.|:    |.:|:|..:...:.:.|.......|.:.....|....|.|    |.:.|... 
Yeast   759 KKVRIQCY----LQLSVSVEDIFKKDIFFFKFLLNSSVREEPVILYSSELSA----PDTRNDYNI 815

  Fly   803 -GSFIFPPDAKIT-------LRC----------SK---NLRIRQARNT---------DDEAAYND 837
             |.:|....|.||       :.|          ||   ||::|.  ||         .|......
Yeast   816 RGDYIATTPALITFDGNESFINCYEITANNNFDSKDIFNLKVRY--NTLKEQLDCFITDAVLIEG 878

  Fly   838 D-------QSFESTLQVPLVQ-----FKSFEERRIPLEVLTDMPGRKVSKHHEH----------- 879
            |       :.:::..::.:::     :.:|:|.||...:.|.:...|......:           
Yeast   879 DVEWFILFEKWKTFWELEILKKLKYDYDAFKENRIIRLLKTSIDLNKTKSKIRNLCIEKAVLDKI 943

  Fly   880 HIALNCPWSRTELPIAVDFQPAMEATCRLHTCGTQKFLQVIMKGMEAHLLLQHAQVKCDVPGVQL 944
            .|.||    :....|||              |.|.      |.....:|:.:...|...:||.: 
Yeast   944 LICLN----KVSRGIAV--------------CNTD------MDEYVRNLVPKQLTVPVQLPGFE- 983

  Fly   945 LDLNPESQQPIEIYKSLTVTYLYEIQVEPLKTEHELPVVKVHFVIKYASLSQPDVWRTYGCAFDL 1009
                                ..:.:|.|.::|.|:    .:|           |...|.|   :.
Yeast   984 --------------------QFFHVQFEQMETSHD----ALH-----------DTIATIG---NS 1010

  Fly  1010 VDYTTLFK-LQAQLEPNELCRLRTVCNMNLKITKVHENPYTDLMYEVLNDQNLWAVCG--RSAGV 1071
            :.||.:.: |..|...:                .:.:..|   ::|:|: .|.|.:.|  |.|..
Yeast  1011 LSYTVIVENLSGQWGQD----------------VIDDGGY---IFEILS-SNEWLIHGQKRCAIK 1055

  Fly  1072 VSMKDVDSHSISLDVMPLSTGFLPMPSIRLSKYTAGGKSKTDGHS 1116
            ...|:.:.|     ::||..|:|..|.:.::  ...|||....||
Yeast  1056 EKRKEFEVH-----LIPLKKGYLNFPRVEIT--NINGKSCRVDHS 1093

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SIDLNP_650431.1 TRAPPC10 978..1138 CDD:289361 29/143 (20%)
TRS130NP_013945.1 TRAPPC10 1003..1101 CDD:289361 26/122 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C339181272
eggNOG 1 0.900 E1_KOG1931
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002999
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13251
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1753
TreeFam 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.