DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SIDL and CLUB

Sequence 1:NP_650431.1 Gene:SIDL FlyBaseID:FBgn0038303 Length:1145 Species:Drosophila melanogaster
Sequence 2:NP_200255.5 Gene:CLUB AraportID:AT5G54440 Length:1259 Species:Arabidopsis thaliana

Alignment Length:1350 Identity:272/1350 (20%)
Similarity:459/1350 (34%) Gaps:436/1350 (32%)


  Fly    42 TKHVRLEAQAQQFNVAALEKYKQGDWSILEHPILHIFVTECNDVDTYKATIREAIDIWLKTLTSY 106
            |...||.::..|      |:|.  .|  ...|...|.:..|.|:|.:|..::..    ||.:...
plant    67 TTDARLRSRFPQ------EQYL--FW--FREPYATIVLVTCEDLDEFKNILKPR----LKLIVQN 117

  Fly   107 GVSDWMILLVETL---DMRKTKNFMPRTTVLDKIRLDFGTKNDDRC--ISVLNP-----AKFEQK 161
            ...:|.|:.|...   :.:.|||.   ..|..|:.:||.:|..:||  :.|..|     ...|.|
plant   118 DEREWFIVFVSKAHPSNDQATKNV---KKVYAKLEVDFSSKKRERCCKLDVHGPEGNFWEDLELK 179

  Fly   162 STESFR-CLVQRIRFLMLTSYNRNIVKYEELIRSKREKRNIEGWDFRQYFFMQEDLALIFEKLEL 225
            .||..| .|.:|.:|            ||:.||...|:|.:..|:|..:|.::|.||.|||...|
plant   180 ITECIRNTLDRRAQF------------YEDEIRKLSEQRFMPIWNFCNFFILKESLAFIFEMAHL 232

  Fly   226 PTEALIQYDELDAMFSQFITHTGLNEKQQWLNHFRKPLDAFHGICLTRADKFEMRNKIRDEGVSL 290
            ..:||.:||||:..:.:.:...|   ||:....|....|  ..:.|....| .:...::|:....
plant   233 HEDALREYDELELCYLETVNMPG---KQRDFGGFDGEDD--QAVLLKPGSK-PLTQIVQDDSFRE 291

  Fly   291 LEFRNYLFERQAYLLLTCNDIPEIAKRLLNFLFSTLREVELIKLECQEGAL--C---CWEFVCAL 350
            .|||.|||..|:.||...|...|:|.|..:|:.|..:.:.|     .|..|  |   .|.....|
plant   292 FEFRQYLFACQSRLLFKLNRPFEVASRGYSFVISFAKALTL-----HESVLPFCMREVWVITACL 351

  Fly   351 EVLQLC-----EQAMEPN-ELTCFQHCAPIWNLAKDKLYELGKLCG----------------LLP 393
            .:::..     :..:.|: |...|:....:::|::.|...||.|.|                :||
plant   352 ALIEATASHHHDGVVAPDIEKEFFRLQGDLYSLSRVKFMRLGYLIGYGTDIEKSPLNSACLSMLP 416

  Fly   394 GCTP------------------------TSEQLHIVVQ---------------------LS---- 409
            ...|                        ||...|..:|                     ||    
plant   417 WPKPAVWPSLPQDASSEVLEKEKTILQATSRTKHFGIQRKALPLEPSVLLRVANRRRASLSTGNI 481

  Fly   410 -------------SGIGDAPSEQHQF-LQATPQLRD-------RSPNRKPKK-----SGAE---- 444
                         ||:..:|...... :||.|..|.       .||..:|.:     ..||    
plant   482 PEMFDGRPSFTEGSGLEASPRTPSSLKVQAPPMSRTNSSPGNFESPLDRPMRLAEIFVAAEHALR 546

  Fly   445 ------QLKEALGSNQAFQKLYLEL---------------------AELAISTYKHVTRLRSARL 482
                  .|.:.|.|.|.|:..||.|                     .|:|...:||         
plant   547 LTISDHDLLKTLSSIQDFENKYLNLTKGAAENYHRSWWKRHGVVLDGEIAAVCFKH--------- 602

  Fly   483 VGLDLGNFYCALNEPHKAVGFFTDLLRELKAENWHMLSSQTLLELANCYRKMGDSLAYTKTCSSI 547
                 |.:..|.|...|....:.       .|.|..|.::.|..||.|.:.:.|...|..:|   
plant   603 -----GKYDLAANSYEKVCALYA-------GEGWQDLLAEVLPNLAQCQKILDDQAGYMSSC--- 652

  Fly   548 SCCAELETLVRTFYFDEFLKSLKTLKTTLSAQPSIENANYCVLEDHFRILDIEVVNQKPIIQDDY 612
                     ||....|:.|.|.|..:...|...::.::              |:.|..|      
plant   653 ---------VRLLSLDKGLFSSKERQAFQSEVVTLAHS--------------EMKNPVP------ 688

  Fly   613 ILVQLKVESLYP-RGVVAENVKLCYELEASSLELAM-----ENVSLTASPSTVKAKDTSSRLKVS 671
                |.|.||.. .|.....::|| :.:..:|.:.:     ::::|.:...|:.|.:.:.     
plant   689 ----LDVSSLITFSGNTGPPLQLC-DGDPGNLSVTVWSGFPDDITLDSLSLTLVATNNTD----- 743

  Fly   672 LQLVYKQDNRLHSAAVACDLPKSKQPVRRTSSTKRKLSPSVQADFTNFVQAENIALQPGVNLIEM 736
                                 :..|.::.:::|                     .|.||.|.|..
plant   744 ---------------------EGGQALKSSAAT---------------------VLNPGRNTITF 766

  Fly   737 KAKATRVGCW------------QFKQLCIS----MSSLEFLSEQLPFMP--------ATFEISTK 777
            .....:.|.:            :|:....|    ..|.:|:|.:.|..|        |..:::..
plant   767 ALPPQKPGSYVLGVVTGQIGRLRFRSHSFSKGGPADSDDFMSYEKPTRPILKVSKPRALVDLAAA 831

  Fly   778 PASATLEFKTLIAG-IVQPISLNVSGG----------------------------------SFIF 807
            .:||.|..:....| ||:||:.::.|.                                  :.:|
plant   832 VSSALLINEAQWIGIIVRPIAYSLKGAILHIDTGPGLKIEDSYGIEMERYMDADCDTGASKAEVF 896

  Fly   808 PPDAKI-TLRCSKNLRIRQARNTDDEAAYND-DQSFESTLQVPLVQFKSFEERR-------IPL- 862
            ..|:.: :.|.|:.|.:     .|.:..::| ..:..|.|.||:   ::..|:.       .|| 
plant   897 VEDSPVSSKRDSEVLNL-----CDGKIVFSDWASNVSSILWVPV---RALSEKLARGSSSVTPLK 953

  Fly   863 -EVLTDMPGRKVSKHHEHHIALNCPWSRTELPIAVDFQPAMEATCRL-HTC--GTQKFLQVIMKG 923
             ::|..|  |.|:...|..:..|..:.||   ||..|....:.|.|: :.|  || ..|||::  
plant   954 QDILEGM--RTVALKLEFGVHHNQIFERT---IAAHFTDPFDVTTRVANKCNDGT-LVLQVML-- 1010

  Fly   924 MEAHLLLQHAQVKCDVPGVQLLDL------NPESQQPIEIYKSLTVT------YLYEIQVEPLKT 976
               |.|::...:..||    .|||      .....:|...:..|.|:      .::.|.::...:
plant  1011 ---HSLVKANLIVLDV----WLDLQDGFIHGQNDGRPTSTFFPLVVSPGSRAAVVFSICLDKSMS 1068

  Fly   977 EH----ELP--VVKVHFVI---KYASLSQP---DVWRTYGCAFDLVDYTTLFKLQAQLE------ 1023
            ..    :||  ::.:.:.|   :.|...:|   |...|.....|||..:.:...:..|:      
plant  1069 SEGKDLQLPESILNIKYGIHGDRAAGAHRPVDADHSETDTEGRDLVFKSAIVLQRPVLDPCLTVG 1133

  Fly  1024 ----PNELCRLRTVCNM--------NLKITKVHENPYTDLMYEVLNDQNLWAVCGRSAGVVSMKD 1076
                |::..|:..:..|        .||.::..|..:.:::|||..:...|.:.||..|.||:.:
plant  1134 FLPLPSDGLRVGKLITMQWRVERLKELKESEAVEQQHDEVLYEVNANSENWMIAGRKRGHVSLSE 1198

  Fly  1077 VDSHSISLDVM--PLSTGFLPMPSIRLSKY-TAGGKSKTDGHSKVHPFPP 1123
            .....:.:.::  ||..|::..|.:.|... .|...|...|...|...||
plant  1199 EQGSRVVISILCVPLVAGYVRPPQLGLPNVEEANVSSNPSGPHLVCVLPP 1248

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SIDLNP_650431.1 TRAPPC10 978..1138 CDD:289361 37/179 (21%)
CLUBNP_200255.5 TRAPPC10 1124..>1241 CDD:289361 24/117 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I1657
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D537782at2759
OrthoInspector 1 1.000 T193017
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13251
Phylome 00.000 Not matched by this tool.
55.160

Return to query results.
Submit another query.