DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SIDL and trpp-10

Sequence 1:NP_650431.1 Gene:SIDL FlyBaseID:FBgn0038303 Length:1145 Species:Drosophila melanogaster
Sequence 2:NP_001122554.2 Gene:trpp-10 WormBaseID:WBGene00022138 Length:1112 Species:Caenorhabditis elegans

Alignment Length:1245 Identity:250/1246 (20%)
Similarity:482/1246 (39%) Gaps:294/1246 (24%)


  Fly     6 IITYSGSCPLFRSLESQILNAIPLDTCEW---------RRTFQRPTKHVRLEAQ---AQQFNVAA 58
            ||:::|....|...:..:::....::..|         |.||  |.|.|..|.:   ..|.:...
 Worm    21 IISHAGVDQSFSVYQHALVSYFSRNSLVWKINNKPFPHRLTF--PLKFVSYEDKLCFGPQISPTE 83

  Fly    59 LEKYKQGDWSILEHPILHIFVTECNDVDTYKATIREAIDIWLKTLTSYGVSDWMILL-VETLDMR 122
            :.|.          ..||:|.......|.|:|.:|..:..|...|.|.....|:|:: ......|
 Worm    84 ITKI----------AFLHVFNINVTSADDYRANVRHNVSDWFAKLNSKSDVQWIIVINTNRAKDR 138

  Fly   123 KTKNFMPRTTVLDKIRLDFGTKNDDRCISVLNPAKFEQKSTESFRCLVQRIRFLMLTSYNRNIVK 187
            ||||     ::::||:.|| .|..:|...:  |...:|   .:|..:||.|:..:.......:..
 Worm   139 KTKN-----SIVEKIKSDF-AKYPNRLFDL--PDTSDQ---AAFVTVVQGIQQFLFQHLTLVMEI 192

  Fly   188 YEELIRSKREKRNIEGWDFRQYFFMQEDLALIFEKLELPTEALIQYDELDAMFSQFITHTGLNEK 252
            :::.::::.|::....|:...||....:.|.::........|:..:|:|:.:..:|:..:|..|.
 Worm   193 WDKSLKNQYERKKQHTWEPFAYFSSMTEYARLYWSFGAIEYAMSIFDDLEKLLHEFVLRSGEPES 257

  Fly   253 QQWLNHF------RKPLDAFHGICLTRADKFEMRNKIRDEGVSLLEFRNYLFERQAYL------- 304
            .:||...      .:|.....|..:.|..|.|         ...|..||||..:|..:       
 Worm   258 PKWLAQLLNTKIDDRPTLISGGFSVQRISKSE---------AHYLGMRNYLLCQQIIMSIHLYQQ 313

  Fly   305 -----------------------LLTCNDIPEIAKRLLNFLFSTLREVELIKLECQEGALCCWEF 346
                                   |:|...:.|     .|.|.:..|::.|         .|||.:
 Worm   314 KMKSNDAAPSLRSDCAVGIMQRALITIEAVKE-----FNNLMNNKRDIPL---------TCCWTW 364

  Fly   347 VCALEVLQLCEQAMEPNELTCFQHCAPI----WNLAK-DKLYELGKLCGLLPGCTPTSEQLHIVV 406
            ....|.|.:|:...:.:.|    :.||:    .:||: |.|:.|.|             ||.:..
 Worm   365 WTVSESLSICQLLCDVSHL----NVAPVILSRLHLARFDALFVLAK-------------QLKLNP 412

  Fly   407 QLSSGIGDAPSEQHQFLQATPQLRDRSPNRKPKKSGAEQLKEALGSNQAFQKLYLELAELAISTY 471
            :.|..:|       ::|.:.          ||....::.|..|:.||:.......::.::.:.:.
 Worm   413 EDSETLG-------KWLLSI----------KPISLESKVLSSAIKSNEQMCTEMEKVHDVCVGSL 460

  Fly   472 KHVTRLRSARLVGLDLGNFYCALNE--PHKAVGFFTDLLREL--KAENWHMLSS--QTLLELANC 530
            .|..|.|....:...|.|:..:.|.  |.:.:.....:|:.|  :|....||.|  ..|||    
 Worm   461 NHANRHRFVWNITYKLFNYLRSSNSKCPLQKLSINRQMLKTLPIQASTAQMLKSLCSELLE---- 521

  Fly   531 YRKMGDSLAYTKTCSSISCCAELETLVRTFYF-------DEFLKSLKTLKTTLSAQPSIENANYC 588
                           |.|...|:.||:  |:.       ||  |.::.|...:..:..|:.    
 Worm   522 ---------------SDSTTDEMLTLI--FFIVQCENGKDE--KIVENLMEKMRKRAEIDG---- 563

  Fly   589 VLEDHFRILDIEVVNQKPI----IQ-DDYILVQLKVESLYPRGVVAENVKLCYELEASSLELAME 648
                  :::|::.::...|    :| |::..||.....|..|.::  :.|:.:.||.:.:||...
 Worm   564 ------KLVDLQSISLAEIDLFNVQIDNFEAVQTTDSILEIRALI--DSKIGFSLENAKIELIFS 620

  Fly   649 NVSLTASPSTVKAKDTSSRLKVSLQLVYKQDNRLHSAAVACDL--------PKSKQPVRRTSSTK 705
            .    |:.|::..:...|.|.:..:   |::|       .|.|        .:|.||:.......
 Worm   621 G----ATTSSIAQQANLSVLSLQHE---KKEN-------ICRLVSEFKLKSQQSAQPIDENGPLS 671

  Fly   706 RKLSPSVQADFTNFVQAENIALQPGVNLIEMKAKATRVGCWQFKQLCISMSSLEFLS----EQLP 766
            .|::          :.|:|:|  ||.|.:|.:...:::||:..::..||..|.:|.:    .:.|
 Worm   672 LKIA----------LNAQNLA--PGNNQLEFRTDISKIGCFVLEKCTISTESFKFATCDVLARRP 724

  Fly   767 FMPATFEISTKPASATL--EFKTLIAGIVQPISLNVSGGSFIFPPDAKITLR-CSKNLRIRQARN 828
              ||.:.||| |.|.|:  :.:...||::|.:.:.|.....| |.:..:|:. .|.|.:.     
 Worm   725 --PALYCIST-PHSVTVINDSQHFYAGVMQNLEIEVEARCDI-PRETLLTVEPSSPNFQF----- 780

  Fly   829 TDDEAAYNDDQSFESTLQVPLVQFKSFEERRIPLEVLTDMPGRKVSKHHEHHIALNCPWSRTELP 893
                  .|:...:.:.||:.|..|.|.|:||:.::|...:.............::...|......
 Worm   781 ------LNESFVWANNLQITLQPFDSMEKRRLHVKVWLKIDSTICESAAVQKRSILVKWMDRRYN 839

  Fly   894 IAVDFQPAMEATCRLHTCGTQKFLQVIMK---GMEAHLLLQHAQVKCDVPGVQLLDLNPESQQPI 955
            :::.|.|.|....:.....|...|:|.:.   |.....:::.|.:..|       .|:.:|    
 Worm   840 LSLQFVPVMVINSKTSMLTTDILLEVELNRAAGPNITTVIESASLTTD-------PLHADS---- 893

  Fly   956 EIYKSLTVTYLYEIQVE-----------PLKTEHELPVVKVH--FVIKYASLSQPDVWRTYGCAF 1007
            :..:|||.|.|.:..:|           .|.|:..|...::|  :.:|.   ..|.:..|:.   
 Worm   894 KFSESLTATPLSQFPIEGDLLSIANLIWKLPTKGSLVKHRLHLDYTVKQ---QDPPLKYTFD--- 952

  Fly  1008 DLVDYT---TLFKLQAQL---EPN-ELCRLRTVCNMNLKITKVHENPYTDLMYEVLN-DQNLWAV 1064
            |:|:.|   ..|::..|:   :|. :|||..:.|:..:.|..:.|...:.|:  ||: |..:|.:
 Worm   953 DIVELTVPDVQFEICTQVLSQQPGAQLCRATSPCHFVISIRFLKEMSCSLLV--VLDADDRMWTL 1015

  Fly  1065 CGRSAGVVSMKDVDSHSISLDVMPLSTGFLPMPSIRLSKYTAGGKSKTDGHSKVHPFPPGQVYNS 1129
            ..|:. :|::||.....::|.::|:..|:||.|::.:.:.....::...|:..:       .:|.
 Worm  1016 VERTK-MVTIKDSGLGQLALTIIPVVAGYLPFPNVSIYECQLVSEAVIPGNDIL-------FFNR 1072

  Fly  1130 TKSMQIHVIA 1139
            :...||.|::
 Worm  1073 SAGKQIRVLS 1082

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SIDLNP_650431.1 TRAPPC10 978..1138 CDD:289361 37/170 (22%)
trpp-10NP_001122554.2 TRAPPC10 959..1081 CDD:289361 29/132 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C339168105
eggNOG 1 0.900 E1_KOG1931
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I3406
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002999
OrthoInspector 1 1.000 T474904
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13251
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1753
TreeFam 1 0.960
109.980

Return to query results.
Submit another query.