DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SIDL and Trappc10

Sequence 1:NP_650431.1 Gene:SIDL FlyBaseID:FBgn0038303 Length:1145 Species:Drosophila melanogaster
Sequence 2:NP_001166999.1 Gene:Trappc10 RGDID:1311263 Length:1259 Species:Rattus norvegicus

Alignment Length:1281 Identity:368/1282 (29%)
Similarity:610/1282 (48%) Gaps:188/1282 (15%)


  Fly     1 MQIKPIITYSGSCPLFRSLESQILNAIPLDTCEWRRTFQRPTKHVRLEAQAQQFNVAALEKYKQG 65
            |:.|||:|.:|...||.|:...:...:|.:..||||::.|..|.:.||:...||....|.  |:|
  Rat    15 MENKPIVTCAGDQNLFTSIYPTLSQQLPREPMEWRRSYGRAPKMIHLESNFVQFKEELLP--KEG 77

  Fly    66 DWSILEHPILHIFVTECNDVDTYKATIREAIDIWLKTLTSYGVSDWMILLVETLDMRKTK-NFMP 129
            :.::|..|.|||:.|||.|.:.||||:::.:..|...|.::...||:|::||....:|.| |.:|
  Rat    78 NKALLTFPFLHIYWTECCDTEVYKATVKDDLTKWQNVLKAHSSVDWLIVVVENDAKKKNKTNILP 142

  Fly   130 RTTVLDKIRLDFGTKNDDRCISVLNPAKFEQKSTESFRCLVQRIRFLMLTSYNRNIVKYEELIRS 194
            ||:::||||.||..|..|||:.:.:|.|...::.||:...:.::|.|:|.|:.:|:.|:|:.:|:
  Rat   143 RTSIVDKIRNDFCNKQSDRCVVLSDPLKDSSRTQESWNAFLTKLRTLLLMSFTKNLGKFEDDMRT 207

  Fly   195 KREKRNIEGWDFRQYFFMQEDLALIFEKLELPTEALIQYDELDAMFSQFITHTGLNEKQQWLNHF 259
            .||||...||.|.:||.:||:||.:||.|:...:||:|||||||:|||::.:.|..:...||..|
  Rat   208 LREKRTEPGWSFCEYFMVQEELAFVFEMLQQFEDALVQYDELDALFSQYVVNFGAGDGANWLTFF 272

  Fly   260 RKPLDAFHGICLTRADKFEMRNKIRDEGVSLLEFRNYLFERQAYLLLTCNDIPEIAKRLLNFLFS 324
            .:|:.:::|:.|.:....|.|..|:.:..:||:.|:|||.||..|||......|:|:|.|..|.|
  Rat   273 CQPVKSWNGLVLRKPIDMEKRELIQKQEATLLDLRSYLFSRQCTLLLFLQRPWEVAQRALELLHS 337

  Fly   325 TLREVELIKLECQEGALCCWEFVCALEVLQ----LCEQAMEPNELTCFQHCAPIWNLAKDKLYEL 385
            .::|::|:::....|||.||.|:..|||||    .|::|...:.:.   |...:|:.|.:||..|
  Rat   338 CVQELKLLEVSVPPGALDCWVFLSCLEVLQRIEGCCDRAQIDSNIA---HMVGLWSYAMEKLKSL 399

  Fly   386 GKLCGLLPGCTPTSEQLHIVVQLSSGIGDAPSEQHQFLQATPQLRDRSPNRKPKKSGAEQLKEAL 450
            |.||||:....|.||.|:..|.|.:|:|....|.....|        ||.:|        |:|||
  Rat   400 GYLCGLVSEKGPNSEDLNRTVDLLAGLGAERPETANTAQ--------SPYKK--------LQEAL 448

  Fly   451 GSNQAFQKLYLELAELAISTYKHVTRLRSARLVGLDLGNFYCALNEPHKAVGFFTDLLRELKAEN 515
            .|.:||:|.||:|:...|..|..:.|:|||:|||.||..||.....|.||..:....|:...||.
  Rat   449 SSVEAFEKHYLDLSHATIEMYTSIGRIRSAKLVGKDLAEFYMRKRSPQKAEMYLQGALKNYMAEG 513

  Fly   516 WHMLSSQTLLELANCYRKMGDSLAYTKTCSSISCCAELETLVRTFYFDEFLKSLKTLKTTLSAQP 580
            |.:..:.|..:||.|.:.:|....|.:|.|.::....|....|..:..|.|        :.::|.
  Rat   514 WALPVTHTRKQLAECQKHLGQMENYLQTSSLLASDHHLTEEERKHFCQEIL--------SFASQQ 570

  Fly   581 SIENANYCVLEDH--FRILDIEVVNQKPIIQDDYIL-VQLKVESLYPRGV----VAENVKLCYEL 638
            ..:..:..||..|  .|:.|:.......::....:| |::.|.|..|..|    :|.||.  :.:
  Rat   571 EDKAGHKVVLPMHSFARLKDLHFDPPNAVVHAGGVLTVEITVCSQMPVPVHVDQIAVNVH--FSI 633

  Fly   639 EASSLELAME----------------NVSLTASP-STVKAKDTSSRLKVSLQLVYKQDNRLHSAA 686
            |.::.....|                ..||..:| :::.|.:.|..|:.|     ..||.|::..
  Rat   634 EKNNYRKTAEWLTKHKTSNGVITFPAEASLFPAPQNSLPALELSEMLERS-----PSDNSLNTTG 693

  Fly   687 VACDLPKSKQPVRRTSSTKRKLSPSVQA--DFTNFVQAENIALQPGVNLIEMKAKATRVGCWQFK 749
            :.|  ......:||..|......||..|  |..:.::..::.||||.|.|..|.:|...|.:..:
  Rat   694 IIC--RNVHMLLRRQESGSSLEPPSGLALEDGAHVLRCTSVTLQPGANKIVFKTQAKEPGTYTLR 756

  Fly   750 QLCISMSSLEFLSEQL-PFMPATFEISTKPASATLE--FKTLIAGIVQPISLNVSGGSFIFPPDA 811
            ||..|:..:.|:...: |.:  .:::.::.....:|  ..:|:|||.|.:...|:.|.:......
  Rat   757 QLRASVGPVWFVLAHIHPIV--QYDVYSQEPQLHVEPLADSLLAGIPQKVKFTVTTGHYTVKDGD 819

  Fly   812 KITLR--------CSKNLRIRQARNTDDE--AAYNDDQSFESTLQVPLVQFKSFEERRIPLEVLT 866
            .:.|.        |....|.....||.:|  :|....||.:....:.|....::......||||:
  Rat   820 SLQLSNVEAMLILCQAENRAVVYSNTREECSSALLRIQSSDKVTSIGLPTAPAYHVIEFELEVLS 884

  Fly   867 DMPG-------------------RKVSKH--H-----EHHIALNCPWSRTELPIAVDFQPAMEAT 905
             :|.                   :|.|:.  |     :|.::::||||.....||:.|.......
  Rat   885 -LPSAPAAVEDSSILGTPELHRKQKDSQRADHCMVTTDHKVSIDCPWSIYSTVIALTFSVPFRTA 948

  Fly   906 CRLHTCGTQKFLQVIMKG---MEAHLLLQHAQVKCDVPGVQLLDLNPESQQPIEIYKSLTVTYLY 967
            ..|.:.||:|::||.::.   ::..|...:.:.|.....::|:.||.:|||  .|:...:|.:::
  Rat   949 HSLLSAGTRKYVQVCVQNLSELDFELSDSNLEDKGHATDLRLVPLNTQSQQ--LIHSKQSVFFVW 1011

  Fly   968 EIQVEPLKTEHELPVVKVHFVIKYASLSQPDV---WRTYGCAFDLVDYTTLFKLQAQLEP---NE 1026
            |:    ..|:...|.:...|.:.::..|...:   .:.|...|.:..:.||:.::|::.|   .|
  Rat  1012 EL----TWTQEPPPPLHCRFSVGFSPASAERLTVSLKPYTYEFQVESFFTLYSVRAEILPASGAE 1072

  Fly  1027 LCRLRTVCNMNLKITK-------------VHENPY--TDLMYEVLNDQNLWAVCGRSAGVVSM-- 1074
            .|:..::|::.:.||:             |....|  |.|||||:::.:.|||||:|.||::|  
  Rat  1073 FCKTGSLCSLEVCITRLADLLDVDKDEALVESEDYFSTKLMYEVVDNSSNWAVCGKSCGVIAMPL 1137

  Fly  1075 KDVDSHSISLDVMPLSTGFLPMPSIRLSKY----------------------------------- 1104
            ....:|.:.::||||..|:||:|.:||.||                                   
  Rat  1138 AAQATHRVHMEVMPLFAGYLPLPDVRLFKYLPHHSAHASQLDADSWIENDSLSVDKHLDDQLDCS 1202

  Fly  1105 ----------TAGGKSKTDGHSKVHPFPPGQVYNSTKSMQIHVIAS 1140
                      |:.|:.|.....::...|.|||:||:..|||.||.|
  Rat  1203 SLRSRGSAHSTSSGEHKGLPMPRLQALPAGQVFNSSTGMQILVIPS 1248

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SIDLNP_650431.1 TRAPPC10 978..1138 CDD:289361 57/228 (25%)
Trappc10NP_001166999.1 Foie-gras_1 <459..548 CDD:288650 30/89 (34%)
TRAPPC10 1018..1246 CDD:289361 57/228 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C339171789
eggNOG 1 0.900 E1_KOG1931
Hieranoid 1 1.000
Homologene 1 1.000 H37751
Inparanoid 1 1.050 475 1.000 Inparanoid score I1414
OMA 1 1.010
OrthoDB 1 1.010 D107574at33208
OrthoFinder 1 1.000 FOG0002999
OrthoInspector 1 1.000 T1087661
orthoMCL 1 0.900 OOG5_135039
Panther 1 1.100 LDO PTHR13251
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.