DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SIDL and trs130

Sequence 1:NP_650431.1 Gene:SIDL FlyBaseID:FBgn0038303 Length:1145 Species:Drosophila melanogaster
Sequence 2:NP_588342.1 Gene:trs130 PomBaseID:SPCC285.14 Length:1150 Species:Schizosaccharomyces pombe

Alignment Length:1327 Identity:256/1328 (19%)
Similarity:452/1328 (34%) Gaps:406/1328 (31%)


  Fly     4 KPIITYSGSCPLFRSLESQILNAIPLDTCEWRRTFQRPTKHVRLEAQAQQFNVAALEKYKQGDWS 68
            |||:.|.....|:.|:.:.|.:.|||...:|..::|. .||. :.:...:| :..||::...|.|
pombe     5 KPIVQYYDPFDLWPSIATDIESKIPLRNLQWVESYQY-KKHT-ITSLDLEF-LPWLEEFSSQDTS 66

  Fly    69 ----ILEHPILHIFVTECNDVDTYKATIREAIDIWLKTLTSYGVSDWMILLVETLDMRKTKNFMP 129
                :|..|::::......|.:.||...:.....|.:.::......|||:||......|..|.:.
pombe    67 KDPTLLNIPLVNMLFLPEQDGEIYKTQHKPLATKWFQKVSKNENQSWMIVLVAEAQQAKRSNSLR 131

  Fly   130 RT-----------TVLDKIRLDFGTKNDDRCISVLNPAKFEQKSTESF----RCLVQRI------ 173
            ||           :.:|::|.||.|.|.:.|:. |:..:|.....|.:    :||...:      
pombe   132 RTHSRSSSYFAVKSTIDRVRGDFNTGNINHCVR-LDYVRFGTPDAEGWNEFLKCLEWAVLSSLDS 195

  Fly   174 RFLMLTSYNRNIVKYEELIRSKREKRNIEGWDFRQYFFMQEDLALIFEKLELPTEALIQYDELDA 238
            |||.|:...|:|..::..|.|          |:..:|..:|.||..|..|.|..|:|.|.:::.:
pombe   196 RFLQLSEQIRSIKLFDSSIFS----------DYLLFFLQKERLAASFFDLVLYRESLEQCEDMFS 250

  Fly   239 MFSQFITHTGLNEKQQWLNHF-------RKPLDAFHGICLTRADKFE-MRNKIRDEGVSLLEFRN 295
            ..|:.|  :.::.|::.::.:       :..|..|:...|....::. :.|.:.|...:|..|..
pombe   251 TLSKII--SAIDGKKENISKYLGEGSDAQPDLKDFNSSFLILGSRYNTLHNLLADGDFTLFHFTL 313

  Fly   296 YLFERQAYLLLTCNDIPEIAKRLLNFLFSTLREVELI------------KLECQEGALCCWEFVC 348
            :|..:...|.|..:|..:        .||||::..|.            .||    .:..:.:.|
pombe   314 FLLSKIILLNLKISDYEK--------AFSTLQQALLFLTSSFFNEFVQNNLE----IIAAFNYDC 366

  Fly   349 ALEVLQLCEQAMEPNELTCFQHCAPIWNLAKDKLYELGKLCGLLPGCTPTSEQLHIVVQLSSGIG 413
            ...:.:...:|:..|:......||.|...|:.:|..:.:...|:...:|.             :.
pombe   367 YTLLFKKITEAIHNNDTPIPLCCAKILLYARRQLTRMARWNNLIDDSSPL-------------LW 418

  Fly   414 DAPS----EQHQFLQATPQLRDRS--PNRKPKKSGAEQLKEALGSNQAFQKLYLELAELAISTYK 472
            ..||    |.|          |.|  .||      .::|.|.:.|..:|...|..|:..|:|.:|
pombe   419 REPSFPLIEHH----------DNSLLDNR------FQKLSETISSTSSFLSEYYRLSSEALSIFK 467

  Fly   473 ----HVTRLRSARLVGL------DLGNFYCAL----------NEP--HKAVGFFTDLLRELKAEN 515
                ..:.:.:|...||      |..|.|.:|          |:|  .|...|:.|||.:|:   
pombe   468 AYKNRYSFVNTACDTGLAQYLLEDYENAYASLKNVDVQTAWSNDPLEEKWSKFYVDLLEKLE--- 529

  Fly   516 WHMLSSQTLLELANCYRKMGDSLAYTKTCSSISCCAELETLVRTFYFDEFLKSLKTLKTTLSAQP 580
                .....||.|:...| |....|.|.                       |.|:..|.|  |:.
pombe   530 ----KFDEALEFASAISK-GKVSIYNKN-----------------------KILELSKKT--AKS 564

  Fly   581 SIENANYCVLEDHFRILDIEVVNQKPII-QDDYILVQLKVESLYPRGVVAENVKLCYELEAS--- 641
            .:.|     |:|.|   .||:.:...:: .||.|.:....||........::|...|.|.:|   
pombe   565 KVWN-----LDDFF---TIEIPHMMAVVPHDDGINLSFMCESKVFDLESVDSVTCNYVLSSSKNP 621

  Fly   642 -SLELAMENVSLTASPSTV-----------------KAKDT---------SSRLKVSLQLVYKQD 679
             :|...:.| |:|.....|                 |.||:         .|..::.:....|..
pombe   622 MNLLFTLHN-SITDGKLNVHCNDIIPGRYHLKTIVFKLKDSVLSFQKDCLHSNKQIEVLNPTKHS 685

  Fly   680 NRLH------------SAAVACDLPKSKQPVRRTSSTKRKLSPSVQADFTN----FVQAE----- 723
            |.|:            ....||......:...:.|.::.|||....:.|||    |:..|     
pombe   686 NHLYILQSKISQQFQNDGIFACIPIMFGERFYKASCSEIKLSYIENSGFTNLEKSFLSEESHCGL 750

  Fly   724 ----------NIALQPGVNLIEMKAKATRVGCWQFKQLCISMSSLEFLSEQLPFMPATFEISTKP 778
                      ||...|||..:.:....|.|...:|      :.:|.::.|               
pombe   751 ESKTDSLVIKNIQKVPGVAKLYIPLTNTPVEGNEF------LINLSYILE--------------- 794

  Fly   779 ASATLEFKTLI----AGIVQ-----------PISLNVSGGSFIFPPDAKITLRCSKNLRIRQARN 828
            :..|:.|..::    ||||:           |::..:    |:.....:..:.||.|...:..:.
pombe   795 SGQTVRFGKVLHIENAGIVEANCEKTNNMRDPLTSTI----FLHIQPKEPIIFCSWNCMRKTKQG 855

  Fly   829 TDDEAAYNDDQSFESTLQVPLVQFKSFEERRIPLEVLTDMPGRKVSKHHEHHI------ALNC-- 885
            |.|..       |:....:|::.         |::..|       |.|.:..:      ::||  
pombe   856 TYDNV-------FDIPYNIPVLS---------PMDCFT-------SCHFDSDMSIDLKFSMNCLR 897

  Fly   886 ------------PWSRTELPIAVDFQPAMEATCRL-----HTCGTQKFLQVIMKGMEAHLL---- 929
                        .|.|.:........|.::..|:.     .|.||....:.|.|.....:|    
pombe   898 LADVVFMKLCVNIWERFDFIDIEHIMPLLDHACQQISLSNITQGTVVLPEEIRKLNGKKILNSFF 962

  Fly   930 ------------LQHAQVKCDVPGVQLLDLNPESQQPIEIYKSLTVTYLYEIQVEPLKTEHELPV 982
                        :||.:.:.....::......|.::.:   |:|...:.....:.||..:.|:..
pombe   963 DNEELRNEFSEFIQHLESEVSFNSLRSFVQEFEKKERL---KNLPFYFSLHQTIGPLPFKDEMQS 1024

  Fly   983 VKVHFVIKYAS---LSQP-DVWRTY------------GCAFDLV----DYTT--LFKLQAQ---- 1021
            ..:.::.|...   |::| ::..|:            |.:|::.    .|||  ||....|    
pombe  1025 TTIEYIWKIPQKVLLNKPTEITLTFLRSLTHSKKEKQGQSFEIFYNFPAYTTTILFAGPTQRKIV 1089

  Fly  1022 LEPNELCRLRTVCNMNLKITKVHENPYTDLMYEVLNDQNLWAVCGRSAGVVSMKDVDSHSISLDV 1086
            .|.|:......|..:.|                             :||.|.:.:|..||...|:
pombe  1090 WEKNQTTAQEQVTAVFL-----------------------------TAGRVMLPEVVVHSKDDDI 1125

  Fly  1087 MPLSTGFLPMPSIRLSKYTAGGKSKTD 1113
            ..|..          :|||..|:...|
pombe  1126 SILKN----------TKYTLVGRPLND 1142

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SIDLNP_650431.1 TRAPPC10 978..1138 CDD:289361 30/163 (18%)
trs130NP_588342.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002999
OrthoInspector 1 1.000 T1125220
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13251
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1753
TreeFam 00.000 Not matched by this tool.
55.130

Return to query results.
Submit another query.