DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SIDL and LOC102724200

Sequence 1:NP_650431.1 Gene:SIDL FlyBaseID:FBgn0038303 Length:1145 Species:Drosophila melanogaster
Sequence 2:XP_011544384.3 Gene:LOC102724200 ID: Length:282 Species:Homo sapiens

Alignment Length:192 Identity:54/193 (28%)
Similarity:88/193 (46%) Gaps:65/193 (34%)


  Fly  1014 TLFKLQAQLEP---NELCRLRTVCNMNLKITKV---------------HENPYTDLMYEVLNDQN 1060
            ||:.::|::.|   .|.||..::|::.:.||::               .|:..|.|||||:::.:
Human    80 TLYNVKAEIFPPSGMEYCRTGSLCSLEVLITRLSDLLEVDKDEALTESDEHFSTKLMYEVVDNSS 144

  Fly  1061 LWAVCGRSAGVVSMKDV--DSHSISLDVMPLSTGFLPMPSIRLSKY------------------- 1104
            .|||||:|.||:||...  .:|.:.::||||..|:||:|.:||.||                   
Human   145 NWAVCGKSCGVISMPVAARATHRVHMEVMPLFAGYLPLPDVRLFKYLPHHSAHSSQLDADSWIEN 209

  Fly  1105 --------------TAGGKSKTDGHS------------KVHPFPPGQVYNSTKSMQIHVIAS 1140
                          ::..||:...||            ::...|.|||:||:...|:.||.|
Human   210 DSLSVDKHGDDQPDSSSLKSRGSVHSACSSEHKGLPMPRLQALPAGQVFNSSSGTQVLVIPS 271

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SIDLNP_650431.1 TRAPPC10 978..1138 CDD:289361 52/189 (28%)
LOC102724200XP_011544384.3 TRAPPC10 89..269 CDD:315292 49/180 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C339171385
eggNOG 1 0.900 E1_KOG1931
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D537782at2759
OrthoFinder 1 1.000 FOG0002999
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13251
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.