DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6654 and Zbtb18

Sequence 1:NP_650429.1 Gene:CG6654 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_006250390.1 Gene:Zbtb18 RGDID:621548 Length:531 Species:Rattus norvegicus

Alignment Length:548 Identity:117/549 (21%)
Similarity:184/549 (34%) Gaps:184/549 (34%)


  Fly     2 DVDKICLTCL-----------------SSTGPLLSIYDGGSGSCLADMIREFTKTKPRRNDNLPE 49
            |:.|:|...|                 ||....:.....||.....|:..:..:.:..:.:.||.
  Rat   117 DIVKVCKKKLKEKATTEADSTKKEEDASSCSDKVESLSDGSSHMAGDLPSDEDEGEDDKLNILPS 181

  Fly    50 KVCLSCLSEISNCYTFKIKCENSSRTLRQLLPNALPEEPDSKVSISCPVATTDQAVQTTSWEPDR 114
            |..|:  :|..|.:   ::..:.:..:.|....|.|....:..:::.|.::|:...|       |
  Rat   182 KRDLA--AEPGNMW---MRLPSDAAGIPQAGGEAEPHATAAGKTVASPCSSTESLSQ-------R 234

  Fly   115 CTASVQTDAVTTTDAEQNTSLIKSTIS----VDLDYEGEGEVFDYELPDEPVEKTTSLILQVQGN 175
            ...||:..|  ..|...:.| :||::|    ::..|....:|....|....|||..|.       
  Rat   235 SVTSVRDSA--DVDCVLDLS-VKSSLSGVENLNSSYFSSQDVLRSNLVQVKVEKEASC------- 289

  Fly   176 LKDEKEVVFTQTNVIYEGDDHELEQQIRECNLAIFEGVDNEAEIITVTAPQVTTRKSAAKLLTQQ 240
              ||.:|   .||      |:::|..                          |.::|.:.....|
  Rat   290 --DESDV---GTN------DYDMEHS--------------------------TVKESVSANNRVQ 317

  Fly   241 ENDKHQTPVGSKEEARELEKEQVPQSAKRTSRRRGVVKQDVPATPPSDAEPSPKQHRLGTQRKLS 305
            ....|..|:......|||::|.             ....|...||.|:.    .|...|.:..| 
  Rat   318 YEPAHLAPLREDSVLRELDRED-------------KASDDEMMTPESER----VQVEGGMESSL- 364

  Fly   306 APRAGTVNGPSTTSGAATTPELKYHCDRCNAGFAVEKSLMIHRRQKGCINRNYKCNECEKVFVSP 370
            .|....:..|:                                      .:.:.|..|.|||.||
  Rat   365 LPYVSNILSPA--------------------------------------GQIFMCPLCNKVFPSP 391

  Fly   371 DHLAEHQASHGAHNCPECGIRCDSKEALSKHMVQGHKRNLRNQCNICQKVFTMLSTLRDHMRIHT 435
            ..|..|.::|...   :.|||  ||.|...::         ..|::|.|.|:.:.||:.|.|.|:
  Rat   392 HILQIHLSTHFRE---QDGIR--SKPAADVNV---------PTCSLCGKTFSCMYTLKRHERTHS 442

  Fly   436 GEKPFVCNICGKSFTQNANLRQHKLRHSETKSFKCELCPHSFVTKAELTSHARTHTGDKPFECEV 500
            ||||:.|..|||||..:.|                            |:.||..||.:||..|:.
  Rat   443 GEKPYTCTQCGKSFQYSHN----------------------------LSRHAVVHTREKPHACKW 479

  Fly   501 CLARFTTSCSLAKHKRKHTGERPYACDL 528
            |..|||.|..|.:|.||      :.|:|
  Rat   480 CERRFTQSGDLYRHIRK------FHCEL 501

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071 14/90 (16%)
C2H2 Zn finger 331..354 CDD:275368 0/23 (0%)
COG5048 <357..570 CDD:227381 55/173 (32%)
C2H2 Zn finger 360..380 CDD:275368 9/20 (45%)
C2H2 Zn finger 385..406 CDD:275370 6/21 (29%)
C2H2 Zn finger 414..434 CDD:275368 8/20 (40%)
zf-H2C2_2 427..451 CDD:290200 14/24 (58%)
C2H2 Zn finger 442..490 CDD:275368 10/48 (21%)
C2H2 Zn finger 470..487 CDD:275368 2/17 (12%)
zf-H2C2_2 482..507 CDD:290200 12/25 (48%)
C2H2 Zn finger 498..518 CDD:275368 10/20 (50%)
zf-H2C2_2 510..534 CDD:290200 6/20 (30%)
C2H2 Zn finger 526..546 CDD:275368 2/4 (50%)
zf-H2C2_2 539..563 CDD:290200
C2H2 Zn finger 554..574 CDD:275368
C2H2 Zn finger 582..602 CDD:275368
Zbtb18XP_006250390.1 BTB 23..119 CDD:279045 1/2 (50%)
BTB 34..119 CDD:197585 1/2 (50%)
COG5048 <360..>490 CDD:227381 52/211 (25%)
C2H2 Zn finger 381..401 CDD:275368 9/20 (45%)
C2H2 Zn finger 421..441 CDD:275368 8/20 (40%)
zf-H2C2_2 434..456 CDD:290200 13/22 (59%)
C2H2 Zn finger 449..469 CDD:275368 10/48 (21%)
C2H2 Zn finger 477..495 CDD:275368 8/18 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.