DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6654 and ZFAT

Sequence 1:NP_650429.1 Gene:CG6654 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_065914.2 Gene:ZFAT HGNCID:19899 Length:1243 Species:Homo sapiens

Alignment Length:601 Identity:127/602 (21%)
Similarity:220/602 (37%) Gaps:148/602 (25%)


  Fly    82 NALPEEPDSKVSISCPVATTDQAVQTTSWEPDR---------CTASVQTDAVTTTDAEQNTSLIK 137
            |||.||       :||   .|..::....||:.         ..||.|.::......|..|:::.
Human   529 NALKEE-------ACP---GDTQLEEGRKEPEAPGEMPAPAVHLASPQAESTALPPCELETTVVS 583

  Fly   138 STISVDLDYEGEGEVFDYELPDEPVEKTTSLILQVQGNLKDEKEVVFTQTNVIYEGDDHELEQQI 202
            |:     |...:..|.|..|                  ||::     |.:...:...:...:.|.
Human   584 SS-----DLHSQEVVSDDFL------------------LKND-----TSSAEAHAAPEKPPDMQH 620

  Fly   203 RECNLAIFEGVDNEAEIITVTAPQVTTRKSAAKLLTQQENDKHQTPVGSKEEARELEK-EQVPQS 266
            |       ..|..:.|:||:.   ::..:||.   :.||:...|:|:|..:....|.. :..|..
Human   621 R-------SSVQTQGEVITLL---LSKAQSAG---SDQESHGAQSPLGEGQNMAVLSAGDPDPSR 672

  Fly   267 AKRTSRRRGVVKQDVPATPPSDAEPSPKQHRLGTQRKLSAPRAGTVNGPSTT---SGAATTPELK 328
            ..|::              |::|.            .|..|.||  .|.:.|   ......||  
Human   673 CLRSN--------------PAEAS------------DLLPPVAG--GGDTITHQPDSCKAAPE-- 707

  Fly   329 YHCDRCNAGFAVEKSLMIHRRQKGCINR------NYKCNECEKVFVSPDHLAEHQASHGAHN--- 384
             |.....|...|..||...:.......|      :.:|..|.|:|....|...|..:|...:   
Human   708 -HRSGITAFMKVLNSLQKKQMNTSLCERIRKVYGDLECEYCGKLFWYQVHFDMHVRTHTREHLYY 771

  Fly   385 CPECGIRCDSKEALSKHMVQGHKRNLRNQC--NICQKVFTMLSTLRDHMRIHTG--EKPFVCNIC 445
            |.:|.....:|..|.:|::|.|. |:..:|  :.|.........|:.|:::||.  ::.:.|.:|
Human   772 CSQCHYSSITKNCLKRHVIQKHS-NILLKCPTDGCDYSTPDKYKLQAHLKVHTALDKRSYSCPVC 835

  Fly   446 GKSFTQNANLRQH-KLRHSET---------------------KSFKCELCPHSFVTK-AELTSHA 487
            .|||:::..::.| |..|.|.                     ::.||..|...|:.. ::|..|.
Human   836 EKSFSEDRLIKSHIKTNHPEVSMSTISEVLGRRVQLKGLIGKRAMKCPYCDFYFMKNGSDLQRHI 900

  Fly   488 RTHTGDKPFECEVCLARFTTSCSLAKHKRKHTGERPYACDLCPMRFTALNVLKNHRRTHTGE-RP 551
            ..|.|.|||:|.:|.....:..:|..|..:|:.|:.:.||:|..:|.:...||:|:..||.: :.
Human   901 WAHEGVKPFKCSLCEYATRSKSNLKAHMNRHSTEKTHLCDMCGKKFKSKGTLKSHKLLHTADGKQ 965

  Fly   552 YVCPFCSKTFTQRGDCQMHQRTHQGERIYICPVCNEEFKSMPEMRSHLAGHEQHDKRLVHFTFLS 616
            :.|..|..|..|:.....|...|...:.:.|..|:........::.|.  :.:|          .
Human   966 FKCTVCDYTAAQKPQLLRHMEQHVSFKPFRCAHCHYSCNISGSLKRHY--NRKH----------P 1018

  Fly   617 NKEN---GSGALEEEL 629
            |:|.   |:|.|..|:
Human  1019 NEEYANVGTGELAAEV 1034

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071
C2H2 Zn finger 331..354 CDD:275368 4/23 (17%)
COG5048 <357..570 CDD:227381 60/244 (25%)
C2H2 Zn finger 360..380 CDD:275368 6/20 (30%)
C2H2 Zn finger 385..406 CDD:275370 6/21 (29%)
C2H2 Zn finger 414..434 CDD:275368 4/22 (18%)
zf-H2C2_2 427..451 CDD:290200 9/26 (35%)
C2H2 Zn finger 442..490 CDD:275368 15/71 (21%)
C2H2 Zn finger 470..487 CDD:275368 5/18 (28%)
zf-H2C2_2 482..507 CDD:290200 9/25 (36%)
C2H2 Zn finger 498..518 CDD:275368 4/20 (20%)
zf-H2C2_2 510..534 CDD:290200 8/24 (33%)
C2H2 Zn finger 526..546 CDD:275368 7/20 (35%)
zf-H2C2_2 539..563 CDD:290200 8/25 (32%)
C2H2 Zn finger 554..574 CDD:275368 5/20 (25%)
C2H2 Zn finger 582..602 CDD:275368 3/20 (15%)
ZFATNP_065914.2 COG5048 <267..426 CDD:227381
zf-C2H2 271..293 CDD:278523
C2H2 Zn finger 273..293 CDD:275368
zf-H2C2_2 285..307 CDD:290200
C2H2 Zn finger 301..321 CDD:275368
C2H2 Zn finger 328..349 CDD:275368
C2H2 Zn finger 356..377 CDD:275368
C2H2 Zn finger 406..426 CDD:275368
C2H2 Zn finger 434..454 CDD:275368
C2H2 Zn finger 460..478 CDD:275368
C2H2 Zn finger 744..764 CDD:275368 6/20 (30%)
C2H2 Zn finger 772..822 CDD:275368 12/51 (24%)
C2H2 Zn finger 832..851 CDD:275368 7/19 (37%)
C2H2 Zn finger 882..903 CDD:275368 5/21 (24%)
C2H2 Zn finger 911..931 CDD:275368 4/20 (20%)
zf-H2C2_2 923..948 CDD:290200 8/25 (32%)
C2H2 Zn finger 939..959 CDD:275368 7/20 (35%)
C2H2 Zn finger 968..988 CDD:275368 5/20 (25%)
C2H2 Zn finger 996..1017 CDD:275368 3/23 (13%)
C2H2 Zn finger 1043..1061 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.