DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6654 and ZNF471

Sequence 1:NP_650429.1 Gene:CG6654 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_065864.2 Gene:ZNF471 HGNCID:23226 Length:626 Species:Homo sapiens

Alignment Length:341 Identity:119/342 (35%)
Similarity:156/342 (46%) Gaps:66/342 (19%)


  Fly   324 TPELKYHCDRCNAGFAVEKSLMIHRR-QKGCINRNYKCNECEKVFVSPDHLAEHQASHGA---HN 384
            |.|..:.|..|...|...:.|:.|:| ..|  .:.|||.||.|.|..|.|||:||..|..   :.
Human   257 TGEKLFECKECRKAFKQSEHLIQHQRIHTG--EKPYKCKECRKAFRQPAHLAQHQRIHTGEKPYE 319

  Fly   385 CPECG------------------------IRC---------------------------DSKEAL 398
            |.|||                        |.|                           |..:|.
Human   320 CKECGKAFSDGSSFARHQRCHTGKRPYECIECGKAFRYNTSFIRHWRSYHTGEKPFNCIDCGKAF 384

  Fly   399 SKHMVQG---HKR----NLRNQCNICQKVFTMLSTLRDHMRIHTGEKPFVCNICGKSFTQNANLR 456
            |.|:  |   |:|    ....:|.:|.|.|:..|:...|.||||||||:.|:||||.|:.:|:|.
Human   385 SVHI--GLILHRRIHTGEKPYKCGVCGKTFSSGSSRTVHQRIHTGEKPYECDICGKDFSHHASLT 447

  Fly   457 QHKLRHSETKSFKCELCPHSFVTKAELTSHARTHTGDKPFECEVCLARFTTSCSLAKHKRKHTGE 521
            ||:..||..|.::|:.|..:|.....|.||.|.|||:||:||:.|...|..|..||.|:|.||||
Human   448 QHQRVHSGEKPYECKECGKAFRQNVHLVSHLRIHTGEKPYECKECGKAFRISSQLATHQRIHTGE 512

  Fly   522 RPYACDLCPMRFTALNVLKNHRRTHTGERPYVCPFCSKTFTQRGDCQMHQRTHQGERIYICPVCN 586
            :||.|..|...|...:.|..|::|||||:||.|..|.|.|:|..:...|||.|.||:.|.|..|.
Human   513 KPYECIECGNAFKQRSHLAQHQKTHTGEKPYECNECGKAFSQTSNLTQHQRIHTGEKPYKCTECG 577

  Fly   587 EEFKSMPEMRSHLAGH 602
            :.|........|...|
Human   578 KAFSDSSSCAQHQRLH 593

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071
C2H2 Zn finger 331..354 CDD:275368 7/24 (29%)
COG5048 <357..570 CDD:227381 98/274 (36%)
C2H2 Zn finger 360..380 CDD:275368 11/20 (55%)
C2H2 Zn finger 385..406 CDD:275370 11/75 (15%)
C2H2 Zn finger 414..434 CDD:275368 8/20 (40%)
zf-H2C2_2 427..451 CDD:290200 15/24 (63%)
C2H2 Zn finger 442..490 CDD:275368 20/48 (42%)
C2H2 Zn finger 470..487 CDD:275368 6/17 (35%)
zf-H2C2_2 482..507 CDD:290200 13/25 (52%)
C2H2 Zn finger 498..518 CDD:275368 8/20 (40%)
zf-H2C2_2 510..534 CDD:290200 13/24 (54%)
C2H2 Zn finger 526..546 CDD:275368 6/20 (30%)
zf-H2C2_2 539..563 CDD:290200 13/24 (54%)
C2H2 Zn finger 554..574 CDD:275368 8/20 (40%)
C2H2 Zn finger 582..602 CDD:275368 4/20 (20%)
ZNF471NP_065864.2 KRAB 14..73 CDD:214630
KRAB 14..53 CDD:279668
COG5048 203..610 CDD:227381 119/342 (35%)
C2H2 Zn finger 208..228 CDD:275368
zf-H2C2_2 220..245 CDD:290200
C2H2 Zn finger 236..256 CDD:275368
zf-H2C2_2 248..273 CDD:290200 5/16 (31%)
C2H2 Zn finger 264..284 CDD:275368 6/20 (30%)
zf-H2C2_2 276..301 CDD:290200 11/27 (41%)
C2H2 Zn finger 292..312 CDD:275368 11/20 (55%)
zf-H2C2_2 304..328 CDD:290200 10/24 (42%)
C2H2 Zn finger 320..340 CDD:275368 4/20 (20%)
zf-H2C2_2 332..357 CDD:290200 2/25 (8%)
C2H2 Zn finger 348..366 CDD:275368 2/18 (11%)
C2H2 Zn finger 377..397 CDD:275368 7/22 (32%)
zf-H2C2_2 393..414 CDD:290200 6/21 (29%)
C2H2 Zn finger 405..425 CDD:275368 8/20 (40%)
zf-H2C2_2 420..442 CDD:290200 15/22 (68%)
C2H2 Zn finger 433..453 CDD:275368 10/20 (50%)
zf-H2C2_2 445..470 CDD:290200 9/25 (36%)
C2H2 Zn finger 461..481 CDD:275368 7/20 (35%)
zf-H2C2_2 473..496 CDD:290200 12/23 (52%)
C2H2 Zn finger 489..509 CDD:275368 8/20 (40%)
zf-H2C2_2 502..526 CDD:290200 13/24 (54%)
C2H2 Zn finger 517..537 CDD:275368 6/20 (30%)
zf-H2C2_2 529..554 CDD:290200 13/25 (52%)
C2H2 Zn finger 545..565 CDD:275368 8/20 (40%)
zf-H2C2_2 557..581 CDD:290200 10/24 (42%)
C2H2 Zn finger 573..593 CDD:275368 4/20 (20%)
C2H2 Zn finger 601..621 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.