DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6654 and zbtb21

Sequence 1:NP_650429.1 Gene:CG6654 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_695193.6 Gene:zbtb21 ZFINID:ZDB-GENE-050411-7 Length:1061 Species:Danio rerio

Alignment Length:762 Identity:145/763 (19%)
Similarity:227/763 (30%) Gaps:279/763 (37%)


  Fly    37 TKTKPRRNDNLPEKVCLSCLSEISNCYTFKIKCENSSRTLRQLLPNALPEEPDSKVSISCPVATT 101
            |.:....|.|..:..|.|.:|..::..          |...:..|..:..:..|.||.|      
Zfish   244 TSSSRHSNSNTVDGSCGSIISSPTSIL----------RRRTEYRPPCMRPQLTSSVSFS------ 292

  Fly   102 DQAVQTTSWEPDRCTASVQTDAVTTTDA--------------EQNTSLIKSTISVDLDYEGEGEV 152
             ::||..|.:.|:...::.....|..|:              :::..||||.:...|..:.....
Zfish   293 -ESVQHASLQSDQADGAIDGGMETLHDSKPVGEHQGLRSQTVDRSGPLIKSLLRRSLSMDSPVPA 356

  Fly   153 FD--YELPD------------------------EPVEKTTSLILQVQGNLKDEKEVVFTQTNVIY 191
            |.  .||.|                        :.|.|...|:|:.:..:..|.    ||||   
Zfish   357 FSPALELKDSQSREQSVVKLMPTLARSPPPELVDQVSKDMPLLLRSRHPIMSEG----TQTN--- 414

  Fly   192 EGDDHELEQQIRECNLAIFEGVDNEAEIITVTAPQVTTRKSAAKLLTQQENDKHQTPVGSKEEAR 256
               .|.::.: ....||      :.:||:.:|...                   ..||..|:  .
Zfish   415 ---QHRIKAE-PSSPLA------DPSEIVRITVGD-------------------NLPVNFKD--F 448

  Fly   257 ELEKEQVPQ-----SAKRTSRRRGVVKQDVPATPPSDAEPSPKQHRLGTQRKL-SAPRAGTVNGP 315
            :...::.|:     |.||.|      |.|....|...:.|..:.|.|..:..| .||....::. 
Zfish   449 QANYDEGPRGYFTASVKRKS------KMDGSYMPFKRSRPVNEHHLLHQETTLDEAPYNSNIDS- 506

  Fly   316 STTSGAATTPELKYHCDRC------NAGFAVEKSLMIHRRQKGCINRNYKCNECEKVFVSPDHLA 374
            .|.......|...:.|..|      |||.....: |.|..:|     .|.|:.|.|.|.:...:.
Zfish   507 CTEEPGELRPNKMFKCWNCLKVFRSNAGLYRHVN-MYHNPEK-----PYACDICHKRFHTNFKVW 565

  Fly   375 EH-QASHGAHNCPECGIRCDS-------------------KEALSKHMVQGHKRNLRNQ------ 413
            .| |..||....|.......|                   |:||...: :..|:.|::|      
Zfish   566 THCQTQHGVVQNPAPSSSSYSVLDEKFQRKLIDIVREREIKKALIMKL-RRTKQGLQSQTFGRKS 629

  Fly   414 -------CNICQKVFTMLSTLRDHMRIHTGEKPFVCNICGKSFTQNANL----------RQHKLR 461
                   |..|.|:|...|.|:.||:.|:.|:              |||          :|.:|.
Zfish   630 RRSRSYGCPFCGKMFFFQSHLKLHMKGHSSEQ--------------ANLETDPEKDLQYKQQQLP 680

  Fly   462 H---SETK-SFKCELCPHSFVTKAELTSHAR-------------------------THTGDKPFE 497
            |   |:.| :|.|.||.....|..||..|.|                         .|...|...
Zfish   681 HFKESQDKDAFSCRLCNEKLPTLTELEDHERACRYATVCPYCGLRFSNTVVKKDHEAHCKYKKLT 745

  Fly   498 CEVCLARFTTSCSLAKHK----------------------------------------RKHTGER 522
            |..|:..|.:|.|:.:|:                                        |....|.
Zfish   746 CLECMRTFKSSFSIWRHQVEVHNHNMMSVKEQLTLSLQESNNNESSNALGVPPTQESIRDPREEA 810

  Fly   523 PYACDLCPMRF-----------------------------TALNVLKNHRRTHTG-ERPYV--CP 555
            .|:....|..:                             .|::...|......| |.|.|  |.
Zfish   811 AYSDSSVPPMYDSEDSSSYVPEDLSAHGQGELQVKEEPQEEAVSAKDNVSGASIGPEEPGVWPCE 875

  Fly   556 FCSKTFTQRGDCQMHQRTHQGERIYICPVCNEEFKSMPEMRSHLAGH 602
            .|.|.|:...|.:.||......:.:||.:|::.|::...:.||...|
Zfish   876 KCGKLFSTHKDLERHQELLCHIKPFICHICHKAFRTNFRLWSHYQSH 922

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071 7/42 (17%)
C2H2 Zn finger 331..354 CDD:275368 8/29 (28%)
COG5048 <357..570 CDD:227381 67/357 (19%)
C2H2 Zn finger 360..380 CDD:275368 6/21 (29%)
C2H2 Zn finger 385..406 CDD:275370 5/40 (13%)
C2H2 Zn finger 414..434 CDD:275368 8/20 (40%)
zf-H2C2_2 427..451 CDD:290200 5/24 (21%)
C2H2 Zn finger 442..490 CDD:275368 17/87 (20%)
C2H2 Zn finger 470..487 CDD:275368 7/17 (41%)
zf-H2C2_2 482..507 CDD:290200 9/50 (18%)
C2H2 Zn finger 498..518 CDD:275368 7/60 (12%)
zf-H2C2_2 510..534 CDD:290200 6/93 (6%)
C2H2 Zn finger 526..546 CDD:275368 3/49 (6%)
zf-H2C2_2 539..563 CDD:290200 9/27 (33%)
C2H2 Zn finger 554..574 CDD:275368 7/20 (35%)
C2H2 Zn finger 582..602 CDD:275368 5/20 (25%)
zbtb21XP_695193.6 BTB 58..156 CDD:279045
BTB 69..154 CDD:197585
C2H2 Zn finger 522..543 CDD:275368 6/22 (27%)
C2H2 Zn finger 637..657 CDD:275368 8/20 (40%)
C2H2 Zn finger 693..712 CDD:275368 8/19 (42%)
C2H2 Zn finger 874..894 CDD:275368 7/20 (35%)
C2H2 Zn finger 902..922 CDD:275368 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.