DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6654 and zbtb22a

Sequence 1:NP_650429.1 Gene:CG6654 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_009292191.2 Gene:zbtb22a ZFINID:ZDB-GENE-101105-1 Length:491 Species:Danio rerio

Alignment Length:464 Identity:103/465 (22%)
Similarity:163/465 (35%) Gaps:144/465 (31%)


  Fly   149 EGEVFDYELPDEPVEKTTSLILQVQGNLKDEKEVVFTQTNVIYEGDDHELEQQIRECNL------ 207
            ||::.|             |.:||||.:......|...::..:.  |..|.:.:...:|      
Zfish    37 EGQLCD-------------LSIQVQGQVFRAHRCVLAASSPYFH--DQVLLKNVTTVSLPSVMDP 86

  Fly   208 AIFEGVDNEA-------------EIITVTA--------PQVTTRKSAAKLLTQ-----QENDKHQ 246
            ..||.|.|.|             ..:||.:        .:.|.....::.|.|     ..:..||
Zfish    87 LAFESVLNSAYTGQLSIVRDDIINYVTVASFLQMWHIVDKCTDILKRSRPLAQISPGGATSSSHQ 151

  Fly   247 TPVGS-------KEEARELEKEQVPQSAKRTSRRRGVVKQDVPATPPSDAEPSPKQHRLGTQRKL 304
            :|..|       ::...|...|:.|.|                |.||......|:|:| .::..|
Zfish   152 SPSSSDCCFADPEDATTEQTLEKRPHS----------------ALPPLATWRRPQQNR-WSRSTL 199

  Fly   305 SAP---------RAGTVNG------PSTTSGAATTPELKY---HCDRCNAGFAVEKSLMIHRRQK 351
            :.|         .|..|:|      ||..|    .|||.:   |..|.....|.|:.  ..||.:
Zfish   200 TFPLRPDSECGSNAAGVHGCSAAPLPSLVS----PPELDFAARHRIRVRLRGAKEEE--EQRRME 258

  Fly   352 GCINRNYKCNECEKVFVSPDHLAEHQASHGAHNCPECGIR-CDSKEALSKHMVQGHKRNLRNQCN 415
            ..........| ::|.|..:   ||||....   |:..:| .:|:|:|.:  ..|..::: .:..
Zfish   259 ADEGVGEPSQE-DRVRVKNE---EHQAGVAE---PDGSLRESESRESLQE--TDGLWQSV-TEWP 313

  Fly   416 ICQKVF-----TMLS-TLRDHMRIHTGE------------------------------KPFVCNI 444
            :..||.     |.|| ...|.:...||:                              |...|: 
Zfish   314 LDDKVLDEDDKTDLSFETYDEIEKATGQISQRPLLPSELSWVSQSSSSSPCSPLSATPKVHFCH- 377

  Fly   445 CGKSFTQNANLRQH-KLRHSETKSFKCELCPHSFVTKAELTSHARTHTGDKPFECEVCLARFTTS 508
            |||::|..:...:| |::|...:.|.|.:|..||..|..||.|.:||.|.:|:||.||..:....
Zfish   378 CGKAYTLKSMRDRHVKMQHLNLRPFSCPVCSKSFKMKHHLTKHVKTHGGLRPYECSVCGKKIVWR 442

  Fly   509 CSLAKHKRK 517
            .|..||:.:
Zfish   443 DSFLKHQAR 451

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071
C2H2 Zn finger 331..354 CDD:275368 5/23 (22%)
COG5048 <357..570 CDD:227381 50/200 (25%)
C2H2 Zn finger 360..380 CDD:275368 7/20 (35%)
C2H2 Zn finger 385..406 CDD:275370 6/22 (27%)
C2H2 Zn finger 414..434 CDD:275368 6/26 (23%)
zf-H2C2_2 427..451 CDD:290200 9/54 (17%)
C2H2 Zn finger 442..490 CDD:275368 18/49 (37%)
C2H2 Zn finger 470..487 CDD:275368 8/17 (47%)
zf-H2C2_2 482..507 CDD:290200 11/25 (44%)
C2H2 Zn finger 498..518 CDD:275368 6/21 (29%)
zf-H2C2_2 510..534 CDD:290200 3/9 (33%)
C2H2 Zn finger 526..546 CDD:275368
zf-H2C2_2 539..563 CDD:290200
C2H2 Zn finger 554..574 CDD:275368
C2H2 Zn finger 582..602 CDD:275368
zbtb22aXP_009292191.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.