DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6654 and Insm1

Sequence 1:NP_650429.1 Gene:CG6654 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_058585.2 Gene:Insm1 MGIID:1859980 Length:521 Species:Mus musculus

Alignment Length:369 Identity:82/370 (22%)
Similarity:134/370 (36%) Gaps:73/370 (20%)


  Fly   264 PQSAKRTSRRRGVVKQDVPATPPSDAEPSPKQHRLGTQRKL-------SAP------RAGTVNGP 315
            |.:|.|...:|......|...||:.|..:|...:....|||       ::|      :.|.|..|
Mouse   194 PAAALRPPGKRPAPPAAVATEPPAKAAKAPSAKKPKAIRKLHFEDEVTTSPVLGLKIKEGPVEAP 258

  Fly   316 STTSGAATTPELKYHCDRCNAGFAVEKSLMIHRRQKGCINRNYKCNECEKVFVSPDHLAEHQASH 380
            ...:|.||.|..::.|..|...:|...:|..|:..: .:...|:|.||.|||..|.:||.|:..|
Mouse   259 RGRAGGATRPLGEFICQLCKEEYADPFALAQHKCSR-IVRVEYRCPECAKVFSCPANLASHRRWH 322

  Fly   381 GAHNC--------PECGIRCDSKEALSKHMVQGHKRNLRNQCNICQKVFTMLSTLRDHMRIHTGE 437
            .....        ||...|.:::||...   ....|:..:...:.:      |...|.:      
Mouse   323 KPRPVPAAARAPEPEAATRAEAREAAGG---GSSDRDTPSPGGVSE------SGSEDGL------ 372

  Fly   438 KPFVCNICGKSFTQNANLRQHKLRHSETKSFKCELCPHSFVTKAELTSHARTHTGDKPFECEVCL 502
              :.|:.|.|.|.:.|.||:|.|.|.:....|                .|.......|...|..|
Mouse   373 --YECHHCAKKFRRQAYLRKHLLAHHQALQAK----------------GAPPPPPPPPPPAEDIL 419

  Fly   503 ARFTTSCSLAKHKRKHTGERPYACDLCPMRFTALNVLKNHRRTHTGERPYVCPFCSKTFTQRGDC 567
            |.:......|..:....||   |..:..:..||              :.::||.|.:||..:|..
Mouse   420 AFYAGPDEKAPQEASGDGE---AAGVLGLSATA--------------QCHLCPVCGETFPSKGAQ 467

  Fly   568 QMHQRTHQGERIYICPVCNEEFKSMPEMRSHL-AGHEQHDKRLV 610
            :.|.|.....:::.|..|...|.|.|.:..|: ..|...:::::
Mouse   468 ERHLRLLHAAQVFPCKYCPATFYSSPGLTRHINKCHPSENRQVI 511

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071
C2H2 Zn finger 331..354 CDD:275368 5/23 (22%)
COG5048 <357..570 CDD:227381 48/221 (22%)
C2H2 Zn finger 360..380 CDD:275368 10/20 (50%)
C2H2 Zn finger 385..406 CDD:275370 5/29 (17%)
C2H2 Zn finger 414..434 CDD:275368 2/20 (10%)
zf-H2C2_2 427..451 CDD:290200 5/24 (21%)
C2H2 Zn finger 442..490 CDD:275368 12/48 (25%)
C2H2 Zn finger 470..487 CDD:275368 0/17 (0%)
zf-H2C2_2 482..507 CDD:290200 5/25 (20%)
C2H2 Zn finger 498..518 CDD:275368 4/20 (20%)
zf-H2C2_2 510..534 CDD:290200 4/24 (17%)
C2H2 Zn finger 526..546 CDD:275368 2/20 (10%)
zf-H2C2_2 539..563 CDD:290200 5/24 (21%)
C2H2 Zn finger 554..574 CDD:275368 8/20 (40%)
C2H2 Zn finger 582..602 CDD:275368 6/21 (29%)
Insm1NP_058585.2 SNAG domain. {ECO:0000305|PubMed:24227653} 1..20
Required and sufficient for interaction with KDM1A. {ECO:0000250|UniProtKB:Q01101} 2..7
Necessary for interaction with CCND1. {ECO:0000250} 43..56
C2H2 Zn finger 274..294 CDD:275368 5/20 (25%)
C2H2 Zn finger 302..322 CDD:275368 10/20 (50%)
zf-C2H2 373..395 CDD:278523 9/22 (41%)
C2H2 Zn finger 375..395 CDD:275368 9/20 (45%)
C2H2 Zn finger 454..475 CDD:275368 8/21 (38%)
C2H2 Zn finger 482..503 CDD:275368 6/21 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.