DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6654 and ZNF571

Sequence 1:NP_650429.1 Gene:CG6654 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_016882344.1 Gene:ZNF571 HGNCID:25000 Length:651 Species:Homo sapiens

Alignment Length:633 Identity:168/634 (26%)
Similarity:253/634 (40%) Gaps:135/634 (21%)


  Fly    86 EEPDSKVSIS--CPVATTDQAVQTT--SWEPDRCTASVQTDAVTTTDAEQNTSLIKSTISVDLD- 145
            |||...:|..  ||   ||.|:..:  .||   |....|.|.......|..::|    ||:||: 
Human    37 EEPRKLISSKKPCP---TDVAIDFSQEEWE---CLDPAQRDLYRDVMLENYSNL----ISLDLES 91

  Fly   146 ------YEGEGEVFDYE-LPDEPVEKTTSLILQVQGNLKDEKEVVFTQTNVIYEGDDHELEQQIR 203
                  ...|.|:::.| |..|.:.|..:..||..| |.|..|   .:.|:  ||.:.. ::.:.
Human    92 SCVTKKLSPEKEIYEMESLQWENMGKRINHHLQYNG-LGDNME---CKGNL--EGQEAS-QEGLY 149

  Fly   204 ECNLAIFEGVDNEAEIITVTAPQ-VTTRKSAAKLLTQQENDKHQTPVGSKEEARELEK-EQVPQS 266
            .|.....|....|:...:.|..: :.|::...|....::...:.:.:...||...:|| .:|.:.
Human   150 MCVKITCEEKATESHSTSSTFHRIIPTKEKLYKCKECRQGFSYLSCLIQHEENHNIEKCSEVKKH 214

  Fly   267 AKRTSRRRGVVKQDVPAT--PPSDAEPSPK---------QH-RLGTQRK---LSAPRAGTVNGPS 316
            ....|::...::.....|  .|.:.....|         || ::.|..|   .:|.....:.|..
Human   215 RNTFSKKPSYIQHQRIQTGEKPYECMECGKAFGRTSDLIQHQKIHTNEKPYQCNACGKAFIRGSQ 279

  Fly   317 TTSGAAT-TPELKYHCDRCNAGFAVEKSLMIHRR---------QKGC------------------ 353
            .|..... |.|..|.|.:|...|:......:|:|         .|.|                  
Human   280 LTEHQRVHTGEKPYECKKCGKAFSYCSQYTLHQRIHSGEKPYECKDCGKAFILGSQLTYHQRIHS 344

  Fly   354 INRNYKCNECEKVFVSPDHLAEHQASHGA-------------------------------HNCPE 387
            ..:.|:|.||.|.|:...||..||..|..                               :.|.|
Human   345 GEKPYECKECGKAFILGSHLTYHQRVHTGEKPYICKECGKAFLCASQLNEHQRIHTGEKPYECKE 409

  Fly   388 CG------------IRCDSKEALSK------------HMVQGHKR----NLRNQCNICQKVFTML 424
            ||            :|..|.|...|            :::| |:|    ....:|..|.|.|...
Human   410 CGKTFFRGSQLTYHLRVHSGERPYKCKECGKAFISNSNLIQ-HQRIHTGEKPYKCKECGKAFICG 473

  Fly   425 STLRDHMRIHTGEKPFVCNICGKSFTQNANLRQHKLRHSETKSFKCELCPHSFVTKAELTSHART 489
            ..|.:|.|||||||||.|..|||:|.:.|.|.||:..|.| |.::|:.|..:||...:||.|.|.
Human   474 KQLSEHQRIHTGEKPFECKECGKAFIRVAYLTQHEKIHGE-KHYECKECGKTFVRATQLTYHQRI 537

  Fly   490 HTGDKPFECEVCLARFTTSCSLAKHKRKHTGERPYACDLCPMRFTALNVLKNHRRTHTGERPYVC 554
            |||:||::|:.|...|.....|::|:|.|.||:||.|..|...|...:.|..|.||||||:||.|
Human   538 HTGEKPYKCKECDKAFIYGSQLSEHQRIHRGEKPYECKQCGKAFIRGSHLTEHLRTHTGEKPYEC 602

  Fly   555 PFCSKTFTQRGDCQMHQRTHQGERIYICPVCNEEFKSMPEMRSHLAGH 602
            ..|.:.|::..:..:|||.|.||:.|.|..|.::|:...::..|...|
Human   603 KECGRAFSRGSELTLHQRIHTGEKPYTCVQCGKDFRCPSQLTQHTRLH 650

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071
C2H2 Zn finger 331..354 CDD:275368 7/50 (14%)
COG5048 <357..570 CDD:227381 89/272 (33%)
C2H2 Zn finger 360..380 CDD:275368 9/20 (45%)
C2H2 Zn finger 385..406 CDD:275370 9/45 (20%)
C2H2 Zn finger 414..434 CDD:275368 8/20 (40%)
zf-H2C2_2 427..451 CDD:290200 16/24 (67%)
C2H2 Zn finger 442..490 CDD:275368 20/48 (42%)
C2H2 Zn finger 470..487 CDD:275368 7/17 (41%)
zf-H2C2_2 482..507 CDD:290200 12/25 (48%)
C2H2 Zn finger 498..518 CDD:275368 6/20 (30%)
zf-H2C2_2 510..534 CDD:290200 11/24 (46%)
C2H2 Zn finger 526..546 CDD:275368 7/20 (35%)
zf-H2C2_2 539..563 CDD:290200 13/24 (54%)
C2H2 Zn finger 554..574 CDD:275368 6/20 (30%)
C2H2 Zn finger 582..602 CDD:275368 4/20 (20%)
ZNF571XP_016882344.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.