DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6654 and CG17802

Sequence 1:NP_650429.1 Gene:CG6654 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_650659.2 Gene:CG17802 FlyBaseID:FBgn0038549 Length:439 Species:Drosophila melanogaster

Alignment Length:604 Identity:121/605 (20%)
Similarity:202/605 (33%) Gaps:190/605 (31%)


  Fly     5 KICLTCLSSTGPLLSIYDGGSGSCLADMIREF---TKTKPRRNDNLPEKVCLSCLSEISNCYTFK 66
            ::|...:.:..| ::|:|..|     .|:|:.   |......:..:|..:|..||..:.:...|:
  Fly     6 RLCGDLIYTQNP-VNIFDENS-----KMVRQIALVTGLWLTDHSKMPRNMCSCCLLSLKSAIAFR 64

  Fly    67 IKCENSSRTLRQLLPNALPEEPDSKVSISCPVATTDQAVQTTSWE--PDRCTASVQTDA---VTT 126
            ..|..::..|                           .:|..|.|  .|.|.|...:||   :..
  Fly    65 QACIKTNNRL---------------------------TIQRRSVEAKDDGCWADPLSDAHEGLKI 102

  Fly   127 TDAEQNTSLIKSTISVDLDY-EGEGEVFDYELPDEPVEKTTSLILQVQGNLKDEK---EVVFTQT 187
            .|||     ::..:..::.| :.||...|::|..:..|::     :|..|.:.|.   |:.|::.
  Fly   103 NDAE-----VEQEVLYEVSYADNEGLEEDHDLYKKEEEES-----EVNENKEFEDIACEIPFSKE 157

  Fly   188 NVIYEGDDHELEQQIRECNLAIFEGVDNEAEIITVTAPQVTTRKSAAKLLTQQENDKHQTPVGSK 252
                  ||.:.:||..|..:....|.|:..|.......|....:|     .|.|.|:.:    |:
  Fly   158 ------DDEQEQQQEYEDMVDKKTGHDDGEESQECEESQPDEEES-----QQNEEDEEE----SQ 207

  Fly   253 EEARELEKEQVPQSAKRTSRRRGVVKQDVPATPPSDAEPSPKQHRLGTQRKLSAPRAGTVNGPST 317
            |:..||.:.:...|             |..|...||.|.:.:|..|...:|              
  Fly   208 EDDDELWQNEDGDS-------------DTDADSMSDIEATSRQSALDEDKK-------------- 245

  Fly   318 TSGAATTPELKYHCDRCNAGFAVEKSLMIHRRQKGCINRNYKCNECEKVFVSPDHLAEHQASHGA 382
                   |..||                        ..|:...|: :..|:.|            
  Fly   246 -------PRRKY------------------------TKRSSPKND-DTDFLKP------------ 266

  Fly   383 HNCPECGIRCDSKEALSKHMVQGHKRNLRNQCNICQKVFTMLSTLRDHMRIHTGEKPFVCNICGK 447
                                                        .:...:.:..:|..:|:.|||
  Fly   267 --------------------------------------------AKKKRKTYISQKVHICDHCGK 287

  Fly   448 SFTQNANLRQHKLRHSETKSFKCELCPHSFVTKAELTSHART-HTGDKPFECEVCLARFTTSCSL 511
            .||...|...|.||||..|.|:|..|......:..|..|.|. |.|:||:.|:.|..||..|...
  Fly   288 KFTDKGNFNLHVLRHSGVKPFECPECGQKEFNRYILNIHIRVKHRGEKPYACQFCDERFVHSTMR 352

  Fly   512 AKHK-RKHTGERP---YACDLCPMRFTALNVLKNHRRTHTGERPYVCPFCSKTFTQRGDCQMHQR 572
            ::|: |.|..::.   :.|:.|..|:.:......|...|||||.:.|..|..:||:..:.:.|.|
  Fly   353 SRHENRVHRNKKTPKNFKCNYCDKRYESNYQRAKHEVVHTGERNFHCEVCKVSFTRNSNLKTHYR 417

  Fly   573 THQGERIYICPVCNEEFKS 591
            :.|.:...|......|..|
  Fly   418 SRQHQNKLIAMSAKSEIDS 436

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071 15/76 (20%)
C2H2 Zn finger 331..354 CDD:275368 0/23 (0%)
COG5048 <357..570 CDD:227381 48/218 (22%)
C2H2 Zn finger 360..380 CDD:275368 3/20 (15%)
C2H2 Zn finger 385..406 CDD:275370 0/21 (0%)
C2H2 Zn finger 414..434 CDD:275368 0/20 (0%)
zf-H2C2_2 427..451 CDD:290200 7/24 (29%)
C2H2 Zn finger 442..490 CDD:275368 19/49 (39%)
C2H2 Zn finger 470..487 CDD:275368 4/17 (24%)
zf-H2C2_2 482..507 CDD:290200 11/26 (42%)
C2H2 Zn finger 498..518 CDD:275368 7/21 (33%)
zf-H2C2_2 510..534 CDD:290200 6/28 (21%)
C2H2 Zn finger 526..546 CDD:275368 4/20 (20%)
zf-H2C2_2 539..563 CDD:290200 10/24 (42%)
C2H2 Zn finger 554..574 CDD:275368 6/20 (30%)
C2H2 Zn finger 582..602 CDD:275368 2/11 (18%)
CG17802NP_650659.2 zf-AD 4..74 CDD:285071 14/74 (19%)
C2H2 Zn finger 282..302 CDD:275368 10/20 (50%)
C2H2 Zn finger 310..331 CDD:275368 5/21 (24%)
C2H2 Zn finger 339..360 CDD:275368 7/21 (33%)
C2H2 Zn finger 371..388 CDD:275370 4/17 (24%)
zf-met 398..421 CDD:289631 7/23 (30%)
C2H2 Zn finger 399..417 CDD:275368 5/18 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I3845
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.