DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6654 and CG17806

Sequence 1:NP_650429.1 Gene:CG6654 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_650658.1 Gene:CG17806 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster

Alignment Length:528 Identity:110/529 (21%)
Similarity:189/529 (36%) Gaps:147/529 (28%)


  Fly     6 ICLTCLSSTGPLLSIYDGGSGSCLADMIREFTKTKPRRNDNLPEKVCLSCLSEISNCYTFKIKCE 70
            :|.||........|::|..:...|::::: .|....|....:|.::|||||.::::...|:.:|.
  Fly     4 LCRTCGQEAEHAKSLFDKEARDVLSNILK-LTGFWLRNQPGVPTRICLSCLLDLNDAIAFRERCI 67

  Fly    71 NSSRTLRQLLPNALPEEPDSKVSISCPVATTDQAVQTTSWEPDRCTASVQTDAVTTTDAEQNTSL 135
            .::                                  :||...:   ..|.|:.|.|..|...:.
  Fly    68 RTN----------------------------------SSWFEKQ---GKQEDSDTETAREGGNNR 95

  Fly   136 IKSTISVDLDYEGEGEVFDYELPDEPVEKTTSLILQVQGNLKDEKEVVFTQTN----VIYEGDDH 196
            ::|.:.|              :|....:.....||..:....|...:...:|.    |:.|....
  Fly    96 LESRVDV--------------MPISIAQPQRRRILPQRSKKVDGVPLKTVETPIYPLVVPEIPPA 146

  Fly   197 ELEQQIRECNLAIFEGVDNEAEIITVTAPQVTTRKSAAKLLTQQENDKHQTPVGSKEEARELEKE 261
            :|...:| |          |..|...:.||:::......:  ..|....:.|...|||.|.|:..
  Fly   147 DLVDPLR-C----------EDPIQVKSEPQLSSDYPVESM--NHEEPASEMPQVMKEEPRTLQVI 198

  Fly   262 QVPQSAKRTSRRRGVVKQ----DVPATPPSDAEPS-PKQHRLGTQRKLSAPRAGTVNGPSTTSGA 321
            ...|..:|..|.:|.:::    |:......|:..: .|:.:..|:.|..|.:.           |
  Fly   199 GEVQKNRRKPRSKGCLEECPGKDMAKIENIDSTTNKTKEEKYATRNKWGAAKR-----------A 252

  Fly   322 ATTPELKYHCDRCNAGFAVEKSLMIH-RRQKGCINRNYKCNECEKVFVSPDHLAEHQASHGAHNC 385
            .......|.||:|...|:.:.:..:| ||.||  .:.::|.||:::                   
  Fly   253 YALEHRLYFCDQCGKTFSEKGNFNVHLRRHKG--TKEFQCQECDRM------------------- 296

  Fly   386 PECGIRCDSKEALSKHMVQGHKRNLRNQCNICQKVFTMLSTLRDHMRI-HTGEKPFVCNICGKSF 449
                       ..::|::     ||                   |:|| |.||.|:||..|||.|
  Fly   297 -----------EFTQHLL-----NL-------------------HVRIKHRGELPYVCKYCGKRF 326

  Fly   450 TQNANLRQHKLRHSET---KSFKCELCPHSFVTKAELTSHARTHTGDKPFECEVCLARFTTSCSL 511
            ........|:..|.|:   :...|..|..:|.|...|..|...|||::||.||:|...|....:|
  Fly   327 DNCLKRLNHERNHKESPVHRPHVCSTCQKAFKTSTALKDHIVVHTGEQPFHCELCQTFFNRRNAL 391

  Fly   512 AKH-KRKH 518
            |.| |.||
  Fly   392 ATHYKSKH 399

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071 16/73 (22%)
C2H2 Zn finger 331..354 CDD:275368 9/24 (38%)
COG5048 <357..570 CDD:227381 43/168 (26%)
C2H2 Zn finger 360..380 CDD:275368 3/20 (15%)
C2H2 Zn finger 385..406 CDD:275370 1/21 (5%)
C2H2 Zn finger 414..434 CDD:275368 3/21 (14%)
zf-H2C2_2 427..451 CDD:290200 13/25 (52%)
C2H2 Zn finger 442..490 CDD:275368 14/51 (27%)
C2H2 Zn finger 470..487 CDD:275368 6/17 (35%)
zf-H2C2_2 482..507 CDD:290200 11/25 (44%)
C2H2 Zn finger 498..518 CDD:275368 9/21 (43%)
zf-H2C2_2 510..534 CDD:290200 6/11 (55%)
C2H2 Zn finger 526..546 CDD:275368
zf-H2C2_2 539..563 CDD:290200
C2H2 Zn finger 554..574 CDD:275368
C2H2 Zn finger 582..602 CDD:275368
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 18/107 (17%)
zf-C2H2 260..282 CDD:278523 8/22 (36%)
C2H2 Zn finger 262..282 CDD:275368 7/20 (35%)
C2H2 Zn finger 290..311 CDD:275368 9/75 (12%)
COG5048 <298..>383 CDD:227381 33/109 (30%)
C2H2 Zn finger 319..339 CDD:275368 6/20 (30%)
C2H2 Zn finger 350..370 CDD:275368 6/20 (30%)
ZnF_U1 375..407 CDD:197732 12/26 (46%)
C2H2 Zn finger 378..396 CDD:275368 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1772
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.