DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6654 and ouib

Sequence 1:NP_650429.1 Gene:CG6654 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_649822.2 Gene:ouib FlyBaseID:FBgn0037618 Length:312 Species:Drosophila melanogaster

Alignment Length:184 Identity:58/185 (31%)
Similarity:92/185 (50%) Gaps:13/185 (7%)


  Fly   395 KEALSKHMVQGHKRNLR-----NQCNICQKVFTMLSTLRDHMRIHTGEKPFVCNICGKSFTQNAN 454
            :|.:.|.:.:..|..||     .:|...||:..:.:.|.|.:        ::|.:||...|....
  Fly   125 EEPMDKTLNRDAKAQLREDGIDEKCVPSQKIIKVSTKLDDQI--------YICELCGTHATSKPT 181

  Fly   455 LRQHKLRHSETKSFKCELCPHSFVTKAELTSHARTHTGDKPFECEVCLARFTTSCSLAKHKRKHT 519
            .::|..:|...:.|.|:.|...|::..||.:|.|.|||::||.|..|..|:.:......|:|.||
  Fly   182 FQRHMRKHRGERPFGCKDCDARFLSAGELRAHHRVHTGEQPFACRFCEKRYVSYMGRLIHERTHT 246

  Fly   520 GERPYACDLCPMRFTALNVLKNHRRTHTGERPYVCPFCSKTFTQRGDCQMHQRT 573
            .:|||.|:.|..:||...|||||...|||||.:.|..|.::|.::.....|.|:
  Fly   247 NDRPYVCEECGKKFTTAYVLKNHMVIHTGERNFRCDICDRSFQRKAHLVTHTRS 300

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071
C2H2 Zn finger 331..354 CDD:275368
COG5048 <357..570 CDD:227381 56/180 (31%)
C2H2 Zn finger 360..380 CDD:275368
C2H2 Zn finger 385..406 CDD:275370 2/11 (18%)
C2H2 Zn finger 414..434 CDD:275368 5/20 (25%)
zf-H2C2_2 427..451 CDD:290200 6/24 (25%)
C2H2 Zn finger 442..490 CDD:275368 14/48 (29%)
C2H2 Zn finger 470..487 CDD:275368 6/17 (35%)
zf-H2C2_2 482..507 CDD:290200 12/25 (48%)
C2H2 Zn finger 498..518 CDD:275368 5/20 (25%)
zf-H2C2_2 510..534 CDD:290200 10/24 (42%)
C2H2 Zn finger 526..546 CDD:275368 9/20 (45%)
zf-H2C2_2 539..563 CDD:290200 12/24 (50%)
C2H2 Zn finger 554..574 CDD:275368 5/21 (24%)
C2H2 Zn finger 582..602 CDD:275368
ouibNP_649822.2 zf-AD 5..78 CDD:214871
COG5048 <158..300 CDD:227381 50/150 (33%)
C2H2 Zn finger 169..189 CDD:275368 5/20 (25%)
C2H2 Zn finger 197..217 CDD:275368 7/20 (35%)
zf-H2C2_2 209..234 CDD:290200 12/25 (48%)
C2H2 Zn finger 225..245 CDD:275368 5/20 (25%)
zf-H2C2_2 241..262 CDD:290200 11/21 (52%)
C2H2 Zn finger 253..273 CDD:275368 9/20 (45%)
zf-H2C2_2 266..288 CDD:290200 11/22 (50%)
C2H2 Zn finger 281..299 CDD:275368 4/18 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I3845
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.