DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6654 and nom

Sequence 1:NP_650429.1 Gene:CG6654 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001262384.1 Gene:nom FlyBaseID:FBgn0037617 Length:370 Species:Drosophila melanogaster

Alignment Length:217 Identity:63/218 (29%)
Similarity:91/218 (42%) Gaps:59/218 (27%)


  Fly   429 DH----MRIHTGEKPFVCNICGKSFTQNANLRQHKLRHSETKSFKCELCPHSFVTKAELTSHART 489
            ||    ::||.      |:.||......::|.:|:..|:..:.:.|:.||.:|:..:||.:|..|
  Fly   173 DHDLPNVQIHK------CDTCGIIKNNKSSLVRHQFEHNGIRPYPCKECPKTFLVASELKAHNLT 231

  Fly   490 HTGDKPFECEVCLARFTTSCSLAKHKRKHTGERPYACDLCPMRFTALNVLKNHRRTHTGERPYVC 554
            |                           ||.|.|:||..|..|:.::...|.|.|.||.|||:||
  Fly   232 H---------------------------HTLEPPFACRYCDRRYFSVVGRKKHERVHTNERPFVC 269

  Fly   555 PFCSKTFTQRGDCQMHQRTHQGERIYICPVCNEEFKSMPEMRSHLAGHEQHDKRLVHFTFLSN-- 617
            ..|.|.||:....:.|...||..|.|.|.||:..|    .::.|||.|           |:||  
  Fly   270 DQCGKAFTRTCILKAHMAVHQVVRKYSCDVCDRSF----SLKKHLATH-----------FISNTH 319

  Fly   618 KENGSGALEEELNEMTESALML 639
            |.|.     |.:...:|...||
  Fly   320 KRNA-----EAVTSSSEYMSML 336

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071
C2H2 Zn finger 331..354 CDD:275368
COG5048 <357..570 CDD:227381 41/145 (28%)
C2H2 Zn finger 360..380 CDD:275368
C2H2 Zn finger 385..406 CDD:275370
C2H2 Zn finger 414..434 CDD:275368 3/9 (33%)
zf-H2C2_2 427..451 CDD:290200 7/26 (27%)
C2H2 Zn finger 442..490 CDD:275368 14/48 (29%)
C2H2 Zn finger 470..487 CDD:275368 7/17 (41%)
zf-H2C2_2 482..507 CDD:290200 5/25 (20%)
C2H2 Zn finger 498..518 CDD:275368 0/20 (0%)
zf-H2C2_2 510..534 CDD:290200 8/24 (33%)
C2H2 Zn finger 526..546 CDD:275368 6/20 (30%)
zf-H2C2_2 539..563 CDD:290200 14/24 (58%)
C2H2 Zn finger 554..574 CDD:275368 6/20 (30%)
C2H2 Zn finger 582..602 CDD:275368 7/20 (35%)
nomNP_001262384.1 zf-AD 5..76 CDD:214871
C2H2 Zn finger 184..204 CDD:275368 5/20 (25%)
C2H2 Zn finger 212..261 CDD:275368 20/76 (26%)
zf-H2C2_2 255..278 CDD:290200 14/23 (61%)
C2H2 Zn finger 269..289 CDD:275368 6/20 (30%)
zf-H2C2_2 282..305 CDD:290200 9/27 (33%)
C2H2 Zn finger 297..313 CDD:275368 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I3845
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.