DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6654 and zbtb14

Sequence 1:NP_650429.1 Gene:CG6654 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_998701.1 Gene:zbtb14 ZFINID:ZDB-GENE-040426-2946 Length:442 Species:Danio rerio

Alignment Length:479 Identity:121/480 (25%)
Similarity:190/480 (40%) Gaps:92/480 (19%)


  Fly   121 TDAVTTTDAEQNTSLIKSTISVDLDYEGEGEVFDYELPDEPVE-KTTSLILQVQGNLKDEKEVVF 184
            ::.|...|.|..|..:|......|    |||..|..:..|.|: :....:|....|...:   :|
Zfish     2 SETVKYVDDEHRTIFLKLLNEQRL----EGEHCDIAVVVEDVKFRAHRCVLAACSNYFKK---LF 59

  Fly   185 TQTNVIYEGDDHELEQ----QIRECNLAIFEGVDN--EAEIITVTAPQVTTRKSAAKLLTQQEND 243
            .:         ||::.    :|......|||.|.|  ....|:|....|....|:.::|..:..|
Zfish    60 KK---------HEVDSSSVIEIDFIRSDIFEEVLNYMYTAKISVKKKDVNLMMSSGQILGIRFLD 115

  Fly   244 KHQTPVGSKEEARELEKEQVPQSAK--RTSRRRGVVKQDVPATPPSDAEPSPKQHRLGTQRKLSA 306
            |   ....|.:....||...|::||  ....:.|:..:|.|.....|.:.      ||.|.  ..
Zfish   116 K---LCSQKRDMSPDEKNGDPRNAKFPYDMVKMGLPMEDPPLNQDGDVQV------LGDQD--DT 169

  Fly   307 PRAGTVNGPSTTSGAATTPELKYHCDRCNAGFAVEKSLMIHRRQK-----GCINRNYKCNECEKV 366
            |....|...........:|         |....|:::::....|:     ||.::     |.|.:
Zfish   170 PSDDIVEEAQGNHELDKSP---------NNALQVQEAILKELAQEDVPKVGCYDQ-----EVEAL 220

  Fly   367 FVSPDHLAEH-QASHGAHNCPEC------GIRCDSKEALSKHMVQGHKRNLRNQCNICQKVFTML 424
            ...|..||.| |....|.:..:.      |....:.:...::::.||:..|  .|.:|.|.|...
Zfish   221 DGEPKELAAHTQTLSFADSMGDVKDTQPPGWSTATADMKFEYLLYGHRDQL--ACQVCGKTFIDE 283

  Fly   425 STLRDHMRIHTGEKPFVCNICGKSFTQNANLRQHKLRHSETKSFKCELCPHSFVTKAELTSHART 489
            :.||.|.::|:.::||:|.||.|:||                            |:|.|..|.:.
Zfish   284 NRLRKHEKLHSADRPFICEICSKAFT----------------------------TQAHLKEHLKI 320

  Fly   490 HTGDKPFECEVCLARFTTSCSLAKHKRKHTGERPYACDLCPMRFTALNVLKNHRRTHTGERPYVC 554
            |||.||:.||.|...|..:..|.||:|.|:.|||:||.:|...|...:.||:|.|.|.||:|:||
Zfish   321 HTGFKPYRCEACGKSFIRAPDLKKHERVHSNERPFACQMCEKAFKHKSHLKDHERRHRGEKPFVC 385

  Fly   555 PFCSKTFTQRGDCQMHQRTHQGER 578
            ..|:|.|.:..|.:.|:.....||
Zfish   386 NSCTKAFAKASDLKRHENNMHSER 409

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071
C2H2 Zn finger 331..354 CDD:275368 5/28 (18%)
COG5048 <357..570 CDD:227381 67/220 (30%)
C2H2 Zn finger 360..380 CDD:275368 7/21 (33%)
C2H2 Zn finger 385..406 CDD:275370 2/27 (7%)
C2H2 Zn finger 414..434 CDD:275368 7/20 (35%)
zf-H2C2_2 427..451 CDD:290200 12/24 (50%)
C2H2 Zn finger 442..490 CDD:275368 10/48 (21%)
C2H2 Zn finger 470..487 CDD:275368 4/17 (24%)
zf-H2C2_2 482..507 CDD:290200 11/25 (44%)
C2H2 Zn finger 498..518 CDD:275368 8/20 (40%)
zf-H2C2_2 510..534 CDD:290200 12/24 (50%)
C2H2 Zn finger 526..546 CDD:275368 7/20 (35%)
zf-H2C2_2 539..563 CDD:290200 13/24 (54%)
C2H2 Zn finger 554..574 CDD:275368 6/20 (30%)
C2H2 Zn finger 582..602 CDD:275368
zbtb14NP_998701.1 BTB 20..123 CDD:279045 26/122 (21%)
BTB 31..122 CDD:197585 22/106 (21%)
COG5048 <273..408 CDD:227381 56/163 (34%)
C2H2 Zn finger 273..293 CDD:275368 7/20 (35%)
zf-H2C2_2 286..310 CDD:290200 12/52 (23%)
zf-C2H2 299..321 CDD:278523 11/50 (22%)
C2H2 Zn finger 301..321 CDD:275368 10/48 (21%)
zf-H2C2_2 313..338 CDD:290200 11/25 (44%)
C2H2 Zn finger 329..349 CDD:275368 8/20 (40%)
zf-H2C2_2 341..366 CDD:290200 12/25 (48%)
C2H2 Zn finger 357..377 CDD:275368 7/20 (35%)
zf-H2C2_2 369..393 CDD:290200 13/24 (54%)
C2H2 Zn finger 385..401 CDD:275368 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.