DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6654 and Kr

Sequence 1:NP_650429.1 Gene:CG6654 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001261181.1 Gene:Kr FlyBaseID:FBgn0001325 Length:502 Species:Drosophila melanogaster

Alignment Length:312 Identity:83/313 (27%)
Similarity:123/313 (39%) Gaps:67/313 (21%)


  Fly   232 SAAKLLTQQENDKHQTPVGSKEEARELEKEQVPQSAKRTSRRRGVVKQDVPATPPSDAEPSPKQH 296
            :|.:.|..|....|..|..             |.|...|....|....:.|.:.|...||:.|..
  Fly   109 AAQQSLPPQGTHLHSPPAS-------------PHSPLSTPLGSGKHPLNSPNSTPQHHEPAKKAR 160

  Fly   297 RLGTQRKLSAPRAGTVNGPSTTSGAATTPELKYHCDRCNAGFAVEKSLMIHRRQKGCINRNYKCN 361
            :|..:::.....:.:||....|||...:|.        ::|                        
  Fly   161 KLSVKKEFQTEISMSVNDMYHTSGGPISPP--------SSG------------------------ 193

  Fly   362 ECEKVFVSPDHLAEHQASHGAHNCPECGIRCDSKEALSKHMVQGHKRNLRNQCNICQKVFTMLST 426
                  .||:  :.|..:.|...|  .|:..|.            .|:....|.||.:.|.....
  Fly   194 ------SSPN--STHDGAGGNAGC--VGVSKDP------------SRDKSFTCKICSRSFGYKHV 236

  Fly   427 LRDHMRIHTGEKPFVCNICGKSFTQNANLRQHKLRHSETKSFKCELCPHSFVTKAELTSHARTHT 491
            |::|.|.|||||||.|..|.|.||::.:|:.|...|:..|.:.|..|...||..|.|..|.|.||
  Fly   237 LQNHERTHTGEKPFECPECHKRFTRDHHLKTHMRLHTGEKPYHCSHCDRQFVQVANLRRHLRVHT 301

  Fly   492 GDKPFECEVCLARFTTSCSLAKHKRKHTGERPYACDLCPMRFTALNVLKNHR 543
            |::|:.||:|..:|:.|..|..|...|.||:|:.|:.|.|:|...:.|.||:
  Fly   302 GERPYTCEICDGKFSDSNQLKSHMLVHNGEKPFECERCHMKFRRRHHLMNHK 353

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071
C2H2 Zn finger 331..354 CDD:275368 1/23 (4%)
COG5048 <357..570 CDD:227381 61/188 (32%)
C2H2 Zn finger 360..380 CDD:275368 3/20 (15%)
C2H2 Zn finger 385..406 CDD:275370 3/21 (14%)
C2H2 Zn finger 414..434 CDD:275368 7/20 (35%)
zf-H2C2_2 427..451 CDD:290200 15/24 (63%)
C2H2 Zn finger 442..490 CDD:275368 17/48 (35%)
C2H2 Zn finger 470..487 CDD:275368 7/17 (41%)
zf-H2C2_2 482..507 CDD:290200 11/25 (44%)
C2H2 Zn finger 498..518 CDD:275368 7/20 (35%)
zf-H2C2_2 510..534 CDD:290200 10/24 (42%)
C2H2 Zn finger 526..546 CDD:275368 7/19 (37%)
zf-H2C2_2 539..563 CDD:290200 3/6 (50%)
C2H2 Zn finger 554..574 CDD:275368
C2H2 Zn finger 582..602 CDD:275368
KrNP_001261181.1 C2H2 Zn finger 224..244 CDD:275368 7/20 (35%)
zf-H2C2_2 237..261 CDD:290200 15/24 (63%)
C2H2 Zn finger 252..272 CDD:275368 7/20 (35%)
zf-H2C2_2 264..289 CDD:290200 8/25 (32%)
C2H2 Zn finger 280..300 CDD:275368 8/20 (40%)
zf-H2C2_2 292..316 CDD:290200 11/24 (46%)
C2H2 Zn finger 308..328 CDD:275368 7/20 (35%)
zf-H2C2_2 321..345 CDD:290200 10/24 (42%)
C2H2 Zn finger 336..352 CDD:275368 6/16 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24390
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.