DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6654 and CG8944

Sequence 1:NP_650429.1 Gene:CG6654 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_573065.1 Gene:CG8944 FlyBaseID:FBgn0030680 Length:762 Species:Drosophila melanogaster

Alignment Length:567 Identity:122/568 (21%)
Similarity:184/568 (32%) Gaps:184/568 (32%)


  Fly   132 NTSLIKSTISVDLDYEGEGEVFDYELPDEPVEKTTSLILQVQGNLKDEKEVVFTQTNVIYEGDDH 196
            |.||.|..|:  ..::....|:..|.....:|||..      ..|...||:.|  .|.:|..:|.
  Fly   299 NISLAKDAIT--RKWDNLRTVYKRECNRMALEKTNI------STLWYFKELHF--LNEVYSYNDK 353

  Fly   197 ELEQQIRECNL-AIFEGVDNEAEIITVTAPQVTTRKSAAKLLTQQEN-----DKHQTPVGSKEEA 255
            ..:..::|.:. ..|..:.|:.              |.||||:..:.     ::......|||..
  Fly   354 MSDAVVKETSYRRRFSAIWNDT--------------STAKLLSMVKRYQCFYNRFDPDYRSKERR 404

  Fly   256 RE------LEKEQV-----PQSAKRTSRRR-GVVKQDVPATPPSDAEPSPKQHRLGTQRKLSAPR 308
            .|      :|.:|:     .|.:||.|:.| ...||              |..||.::|      
  Fly   405 GEGLHQMAIELQQLIDVTTIQISKRISQLRFDYSKQ--------------KMERLNSER------ 449

  Fly   309 AGTVNGPSTTSGAATTPELKYHCDRCNAGFAVEKSLMIHRRQKGCINRNYKCNEC--EKVFVSPD 371
                                                         :.:.:..|..  :::....|
  Fly   450 ---------------------------------------------LGKKFIANYLYYDQMHFMDD 469

  Fly   372 HLAEHQASHGAHNCPECGIRCDSKEALSKHMVQGHKRNLRN--QCNICQKVFTMLSTLRDHMRIH 434
            .:...:.:|    |||.   ..:...|..||:. |:.:|..  .||||...|.......:|.::|
  Fly   470 DIPPFKCAH----CPEI---VQTLRELDLHMLT-HQPSLGGGYYCNICSIQFHNAQEFDNHKQLH 526

  Fly   435 TG---EKPFVCNICGKSFTQNANLRQHKLRHSETKSFKCELCPHSFVT----------------- 479
            .|   |..|.|.:|..||.:.||..:|..||:|..........||.:.                 
  Fly   527 LGGVTEIKFNCELCTASFREKANYDEHLRRHNEELFLPSLALNHSIMEGGLGDDEIGVEGEESRG 591

  Fly   480 --KAELTSHARTHTGD------------------------KPFECEVCLARFTTSCSLAKHKRKH 518
              ......||...|.|                        ||:.|:||...|.|...|..|:..|
  Fly   592 SGSRRKRRHAAKATDDMVDDDDRIGGGGGGGSGGGGTDIAKPYGCDVCRRSFATPGHLNAHRIVH 656

  Fly   519 TGERP--YACDL--CPMRFTALNVLKNHRRTHTGERPYVCPFCSKTFTQRGDCQMHQRTHQGERI 579
            ..||.  |.||.  |...|.|.|.|..|.:.|.....:.|..|.|||....:.|.|::.|...:.
  Fly   657 QDERERCYKCDYPQCNKSFVARNSLFEHLKQHYSNEEFKCDICGKTFKSTKNLQNHKQIHDKIKR 721

  Fly   580 YICPVCNEEFKSMPEMRSHLAGHEQHDKRLVHFTFLSNKENGS-GAL 625
            |:|.:|...|       :..||...|.:|       .|:.||: ||:
  Fly   722 YVCQICGSAF-------AQAAGLYLHKRR-------HNRPNGAVGAV 754

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071
C2H2 Zn finger 331..354 CDD:275368 0/23 (0%)
COG5048 <357..570 CDD:227381 65/267 (24%)
C2H2 Zn finger 360..380 CDD:275368 2/22 (9%)
C2H2 Zn finger 385..406 CDD:275370 6/21 (29%)
C2H2 Zn finger 414..434 CDD:275368 6/20 (30%)
zf-H2C2_2 427..451 CDD:290200 9/27 (33%)
C2H2 Zn finger 442..490 CDD:275368 14/67 (21%)
C2H2 Zn finger 470..487 CDD:275368 3/36 (8%)
zf-H2C2_2 482..507 CDD:290200 10/49 (20%)
C2H2 Zn finger 498..518 CDD:275368 7/20 (35%)
zf-H2C2_2 510..534 CDD:290200 10/28 (36%)
C2H2 Zn finger 526..546 CDD:275368 8/22 (36%)
zf-H2C2_2 539..563 CDD:290200 8/24 (33%)
C2H2 Zn finger 554..574 CDD:275368 7/20 (35%)
C2H2 Zn finger 582..602 CDD:275368 5/20 (25%)
CG8944NP_573065.1 MADF_DNA_bdg 259..344 CDD:287510 14/55 (25%)
MADF 379..472 CDD:214738 22/158 (14%)
C2H2 Zn finger 476..496 CDD:275368 7/28 (25%)
C2H2 Zn finger 506..526 CDD:275368 6/20 (30%)
C2H2 Zn finger 537..557 CDD:275368 8/20 (40%)
C2H2 Zn finger 636..656 CDD:275368 7/20 (35%)
zf-C2H2_8 639..712 CDD:292531 24/73 (33%)
C2H2 Zn finger 666..688 CDD:275368 8/22 (36%)
zf-C2H2 694..716 CDD:278523 7/22 (32%)
C2H2 Zn finger 696..716 CDD:275368 7/20 (35%)
zf-H2C2_2 708..733 CDD:290200 7/32 (22%)
C2H2 Zn finger 724..744 CDD:275368 7/34 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24390
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.