DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6654 and ZBTB38

Sequence 1:NP_650429.1 Gene:CG6654 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_016861539.1 Gene:ZBTB38 HGNCID:26636 Length:1221 Species:Homo sapiens

Alignment Length:734 Identity:149/735 (20%)
Similarity:246/735 (33%) Gaps:245/735 (33%)


  Fly    52 CLSCLSEISNCYTFKIKCENSSRTLRQLLPNALPEEPDSKVSISCPVATTDQAVQTTSWE----- 111
            |:.||......|..|    |..::...:         |.::|||...|..........::     
Human   544 CIFCLETFMTYYILK----NHQKSFHAI---------DHRLSISKKTANGGLKPSVYPYKLYRLL 595

  Fly   112 PDRCTASVQTDAVTTT--DAEQNTSLIKS---TISVDLDYEGEGEVFDYE--------LPDEPVE 163
            |.:|..:.......::  :|.:|:.:.:|   |..|...:..|....:::        .|..|:|
Human   596 PMKCKRAPYKSYRNSSYENARENSQMNESAPGTYVVQNPHSSELPTLNFQDTVNTLTNSPAIPLE 660

  Fly   164 -------KTTSLILQVQGN------LKDEKEVVFTQTNVIYEGDDHELEQQIRECN---LAIFEG 212
                   .|::.:...:|.      ||.:.:..|..|.|.....::.:...:|..:   |::...
Human   661 TSACQDIPTSANVQNAEGTKWGEEALKMDLDNNFYSTEVSVSSTENAVSSDLRAGDVPVLSLSNS 725

  Fly   213 VDNEAEIITV--TAPQVTTRKS----------AAKLLTQQENDKHQTPVGS---KEEAR-ELEK- 260
            .:|.|.:|:.  :||.|....|          |...:|...:.....|..|   |:::: |.:| 
Human   726 SENAASVISYSGSAPSVIVHSSQFSSVIMHSNAIAAMTSSNHRAFSDPAVSQSLKDDSKPEPDKV 790

  Fly   261 -------EQVPQSAKRTSRRRGVVKQD--VPATPPSD-------AEPSPKQHRLGTQRKLSAPRA 309
                   :.:.:..|.||..||.:.::  ..|.|...       ||.:.|     .:..::.|  
Human   791 GRFASRPKSIKEKKKTTSHTRGEIPEESNYVADPGGSLSKTTNIAEETSK-----IETYIAKP-- 848

  Fly   310 GTVNGPSTTSGAATTPELKYHCDRCNAGFAVEKSLMIHRRQKG---------------------- 352
             .:.|.||.|..|..         |.....:....::.|...|                      
Human   849 -ALPGTSTNSNVAPL---------CQITVKIGNEAIVKRHILGSKLFYKRGRRPKYQMQEEPLPQ 903

  Fly   353 --------------CINRNYKCNECEKVFVSPDHLAEHQAS------------------------ 379
                          |   ..:|.|..:||   |..::..::                        
Human   904 GNDPEPSGDSPLGLC---QSECMEMSEVF---DDASDQDSTDKPWRPYYNYKPKKKSRQLKKMRK 962

  Fly   380 ------HG----AHNCP-----ECGI-----------------------RCDSKEALSKHMVQGH 406
                  ||    :|.|.     :|.:                       .||..:|:........
Human   963 VNWRKEHGNRSPSHKCKYPAELDCAVGKAPQDKPFEEEETKEMPKLQCELCDGDKAVGAGNQGRP 1027

  Fly   407 KRNLRNQ---CNICQKVFTMLSTLRDHMRIHTGEKPFVCNICGKSFTQNANLRQHKLRHSETKSF 468
            .|:|.::   |.:|.|.|...|||:.|||.||||||:.|..||:.|:...||::|:         
Human  1028 HRHLTSRPYACELCAKQFQSPSTLKMHMRCHTGEKPYQCKTCGRCFSVQGNLQKHE--------- 1083

  Fly   469 KCELCPHSFVTKAELTSHARTHTGDKPFECEVCLARFTTSCSLAKHKRKHTGERPYACDLCPMRF 533
                               |.|.|.|.|.|:.|...||.:.:|..|:|.||||:.|.|..|..||
Human  1084 -------------------RIHLGLKEFVCQYCNKAFTLNETLKIHERIHTGEKRYHCQFCFQRF 1129

  Fly   534 TALNVLKNHRRTHTGE---RPYVCPFCSKTFTQRGDCQMHQRTH------QGERIYICPVCNEEF 589
            ..|:..:||.:.|..|   :.|.|..|.|.........|||:.|      |.|:  |..||:|  
Human  1130 LYLSTKRNHEQRHIREHNGKGYACFQCPKICKTAAALGMHQKKHLFKSPSQQEK--IGDVCHE-- 1190

  Fly   590 KSMPEMRSHLAGHEQHDKR 608
            .|.|....|..|.|.:|::
Human  1191 NSNPLENQHFIGSEDNDQK 1209

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071 6/27 (22%)
C2H2 Zn finger 331..354 CDD:275368 4/59 (7%)
COG5048 <357..570 CDD:227381 69/281 (25%)
C2H2 Zn finger 360..380 CDD:275368 5/50 (10%)
C2H2 Zn finger 385..406 CDD:275370 5/49 (10%)
C2H2 Zn finger 414..434 CDD:275368 10/20 (50%)
zf-H2C2_2 427..451 CDD:290200 14/24 (58%)
C2H2 Zn finger 442..490 CDD:275368 8/48 (17%)
C2H2 Zn finger 470..487 CDD:275368 0/17 (0%)
zf-H2C2_2 482..507 CDD:290200 9/25 (36%)
C2H2 Zn finger 498..518 CDD:275368 7/20 (35%)
zf-H2C2_2 510..534 CDD:290200 12/24 (50%)
C2H2 Zn finger 526..546 CDD:275368 7/20 (35%)
zf-H2C2_2 539..563 CDD:290200 8/27 (30%)
C2H2 Zn finger 554..574 CDD:275368 6/20 (30%)
C2H2 Zn finger 582..602 CDD:275368 7/20 (35%)
ZBTB38XP_016861539.1 BTB 49..148 CDD:279045
BTB 60..156 CDD:197585
C2H2 Zn finger 370..390 CDD:275368
C2H2 Zn finger 399..418 CDD:275368
C2H2 Zn finger 488..508 CDD:275368
C2H2 Zn finger 516..536 CDD:275368
C2H2 Zn finger 544..562 CDD:275368 6/22 (27%)
C2H2 Zn finger 1038..1058 CDD:275368 10/20 (50%)
zf-H2C2_2 1051..1074 CDD:290200 14/23 (61%)
zf-C2H2 1064..1086 CDD:278523 8/50 (16%)
C2H2 Zn finger 1066..1086 CDD:275368 8/48 (17%)
zf-H2C2_2 1078..1102 CDD:290200 11/52 (21%)
C2H2 Zn finger 1094..1114 CDD:275368 7/20 (35%)
zf-H2C2_2 1107..1131 CDD:290200 12/24 (50%)
C2H2 Zn finger 1122..1146 CDD:275368 9/24 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.