DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6654 and Zfp791

Sequence 1:NP_650429.1 Gene:CG6654 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001032834.1 Gene:Zfp791 MGIID:3648473 Length:528 Species:Mus musculus

Alignment Length:315 Identity:104/316 (33%)
Similarity:144/316 (46%) Gaps:41/316 (13%)


  Fly   324 TPELKYHCDRCNAGFAVEKSLMIHRR-QKGCINRNYKCNECEKVFVSPDHLAEHQASHGA----- 382
            |.|..|.|::|...|:...|:.||.| ..|  .:.|||.||.|.|:|...:..|..:|..     
Mouse   218 TGEKPYVCEKCGKAFSCPSSIQIHERTHTG--EKPYKCKECGKAFISRTSVKTHMVTHSGDANKP 280

  Fly   383 HNCPECG------------------------------IRCDSKEALSKHMVQGHKRNLRNQCNIC 417
            |.|..||                              .||.:...:.|....|.|   ..:|..|
Mouse   281 HKCEHCGKAFLRPCFLRVHTRIHTGEKPYVCKQCGKAFRCSTSMQIHKRTHTGEK---PYKCKEC 342

  Fly   418 QKVFTMLSTLRDHMRIHTGEKPFVCNICGKSFTQNANLRQHKLRHSETKSFKCELCPHSFVTKAE 482
            .|.|:..|..|.|.|:||||||:.|..|||:|......|.|:.:||..||::|:.|..:||:...
Mouse   343 GKAFSAHSAFRVHRRVHTGEKPYKCRDCGKAFICLTYCRAHERKHSGEKSYECDQCGKAFVSLEN 407

  Fly   483 LTSHARTHTGDKPFECEVCLARFTTSCSLAKHKRKHTGERPYACDLCPMRFTALNVLKNHRRTHT 547
            ...|.:||..|.|::|:.|...|....:|..|:|.||||:||.|:.|...|...:.::.|||.||
Mouse   408 FRRHVKTHAEDTPYKCKECGKAFVFLSALQAHERIHTGEKPYECEQCGKTFRCSSYVQVHRRIHT 472

  Fly   548 GERPYVCPFCSKTFTQRGDCQMHQRTHQGERIYICPVCNEEFKSMPEMRSHLAGH 602
            ||:||.|..|.|||......:.|.|.|.||:.|.|..|.:.|:....::.|...|
Mouse   473 GEKPYECKECGKTFIYSTSFRGHMRMHTGEKPYKCKGCEKAFRLGSSLKRHERTH 527

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071
C2H2 Zn finger 331..354 CDD:275368 8/24 (33%)
COG5048 <357..570 CDD:227381 82/248 (33%)
C2H2 Zn finger 360..380 CDD:275368 7/20 (35%)
C2H2 Zn finger 385..406 CDD:275370 7/51 (14%)
C2H2 Zn finger 414..434 CDD:275368 8/20 (40%)
zf-H2C2_2 427..451 CDD:290200 14/24 (58%)
C2H2 Zn finger 442..490 CDD:275368 17/48 (35%)
C2H2 Zn finger 470..487 CDD:275368 5/17 (29%)
zf-H2C2_2 482..507 CDD:290200 8/25 (32%)
C2H2 Zn finger 498..518 CDD:275368 6/20 (30%)
zf-H2C2_2 510..534 CDD:290200 12/24 (50%)
C2H2 Zn finger 526..546 CDD:275368 6/20 (30%)
zf-H2C2_2 539..563 CDD:290200 14/24 (58%)
C2H2 Zn finger 554..574 CDD:275368 7/20 (35%)
C2H2 Zn finger 582..602 CDD:275368 4/20 (20%)
Zfp791NP_001032834.1 KRAB 4..61 CDD:214630
KRAB 4..43 CDD:279668
COG5048 100..523 CDD:227381 102/310 (33%)
C2H2 Zn finger 104..124 CDD:275368
C2H2 Zn finger 141..161 CDD:275368
C2H2 Zn finger 169..189 CDD:275368
C2H2 Zn finger 197..217 CDD:275368
zf-H2C2_2 209..234 CDD:290200 6/16 (38%)
C2H2 Zn finger 225..245 CDD:275368 7/20 (35%)
zf-H2C2_2 237..262 CDD:290200 12/27 (44%)
C2H2 Zn finger 253..273 CDD:275368 7/20 (35%)
C2H2 Zn finger 283..303 CDD:275368 3/20 (15%)
zf-H2C2_2 296..320 CDD:290200 1/24 (4%)
C2H2 Zn finger 311..331 CDD:275368 3/20 (15%)
zf-H2C2_2 323..347 CDD:290200 7/27 (26%)
C2H2 Zn finger 339..359 CDD:275368 8/20 (40%)
zf-H2C2_2 351..374 CDD:290200 13/23 (57%)
C2H2 Zn finger 367..387 CDD:275368 7/20 (35%)
C2H2 Zn finger 395..415 CDD:275368 6/20 (30%)
C2H2 Zn finger 423..443 CDD:275368 6/20 (30%)
zf-H2C2_2 435..460 CDD:290200 12/25 (48%)
C2H2 Zn finger 451..471 CDD:275368 6/20 (30%)
zf-H2C2_2 463..488 CDD:290200 14/25 (56%)
C2H2 Zn finger 479..499 CDD:275368 7/20 (35%)
zf-H2C2_2 491..514 CDD:290200 8/23 (35%)
C2H2 Zn finger 507..527 CDD:275368 4/20 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.