DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6654 and Zbtb34

Sequence 1:NP_650429.1 Gene:CG6654 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001078976.1 Gene:Zbtb34 MGIID:2685195 Length:518 Species:Mus musculus

Alignment Length:515 Identity:117/516 (23%)
Similarity:182/516 (35%) Gaps:114/516 (22%)


  Fly    70 ENSSRTLRQLLPNALPEEP---DSKVSISCPVATTDQAVQTTSWEPDRCTASVQTDAVTTTDAEQ 131
            |:||..|.||  |.|..:.   |..|.|........:||...|....|..:::.|.:..:....:
Mouse    31 EHSSTVLSQL--NELRLQGKLCDIIVHIQGQPFRAHKAVLAASSPYFRDHSALSTMSGLSISVIK 93

  Fly   132 NTSLIKSTISVDLDYEGEGEVFDYELPDEPVEKTTSLILQVQGNLKDEKEVVFTQTNVIYEGDDH 196
            |.|:.:..:|  ..|.|.   ...:|.|.....|.:..||:|..:....:::.:..:.|..||..
Mouse    94 NPSVFEQLLS--FCYTGR---MSLQLKDVVSFLTAASFLQMQCVIDKCTQILESIHSKISVGDVD 153

  Fly   197 EL---EQQIRECNLAIFEG--VDNEAEIITVTAPQV------------TTRKSAAKLLTQQENDK 244
            .:   .::..|....:.:|  ..|..||.....|||            ||...|.:...|:|...
Mouse   154 SVTIGAEENPESRNGVKDGSFFTNPVEISPPYCPQVRQPPVSSDLRMETTPNKALRSRLQEEGHS 218

  Fly   245 HQTPVGSKEEAR---ELEKEQ---VPQSAKRTSRRRGVVKQDVPATPPSDAEPSPKQH------- 296
            .:...||..|..   |.:.||   :.:.::.|..:..:.|.|.|:...|.:......|       
Mouse   219 DRGSSGSVSEYEIQIEGDHEQGDLLVRESQITEVKVKMEKSDRPSCSDSSSLGDDGYHTEMVDGE 283

  Fly   297 --------RLGTQRKLSAPRAGTVNGPSTTSGA------ATTPELKYHCDRCNAGFAVEKSLMIH 347
                    ..|:..:.:.|.:.|.:.||:...|      ::.......|.| ..|...:::|.:|
Mouse   284 QVVAVNVGAYGSVLQHAYPYSQTASQPSSVPEAFGGQTNSSPSRSMLSCFR-GRGARQKRALSVH 347

  Fly   348 RRQKGCINRNYKCNECEKVFVSPDHLAEHQASHGAHNCPECGIRCDSKEALSKHMVQGHKRNLRN 412
            ..           ::.:.|....|       |....|.|  |.....:|..::.  ..:..|.|.
Mouse   348 LH-----------SDLQGVVQGSD-------SEAMMNNP--GYESSPRERSARG--YWYPYNERL 390

  Fly   413 QCNICQKVFTMLSTLRDHMRIHTGEKPFVCNICGKSFTQNANLRQHKLRHSETKSFKCELCPHSF 477
            .|..|.|.|....:|..|||:|.|..||||..|||.:|:                          
Mouse   391 ICIYCGKSFNQKGSLDRHMRLHMGITPFVCKFCGKKYTR-------------------------- 429

  Fly   478 VTKAELTSHARTHTGDKPFECEVCLARFTTSCSLAKHKRK-HTG--------ERPYACDL 528
              |.:|..|.|.||.||||.||||...|....:|.:|.|| |.|        |.|...|:
Mouse   430 --KDQLEYHIRGHTDDKPFRCEVCGKCFPFQGTLNQHLRKNHPGVTEGRGRMESPERTDM 487

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071 5/9 (56%)
C2H2 Zn finger 331..354 CDD:275368 5/23 (22%)
COG5048 <357..570 CDD:227381 51/182 (28%)
C2H2 Zn finger 360..380 CDD:275368 3/20 (15%)
C2H2 Zn finger 385..406 CDD:275370 3/21 (14%)
C2H2 Zn finger 414..434 CDD:275368 8/20 (40%)
zf-H2C2_2 427..451 CDD:290200 14/24 (58%)
C2H2 Zn finger 442..490 CDD:275368 9/48 (19%)
C2H2 Zn finger 470..487 CDD:275368 3/17 (18%)
zf-H2C2_2 482..507 CDD:290200 14/25 (56%)
C2H2 Zn finger 498..518 CDD:275368 9/21 (43%)
zf-H2C2_2 510..534 CDD:290200 9/29 (31%)
C2H2 Zn finger 526..546 CDD:275368 1/4 (25%)
zf-H2C2_2 539..563 CDD:290200
C2H2 Zn finger 554..574 CDD:275368
C2H2 Zn finger 582..602 CDD:275368
Zbtb34NP_001078976.1 BTB 40..140 CDD:279045 22/107 (21%)
BTB 51..142 CDD:197585 19/96 (20%)
C2H2 Zn finger 392..412 CDD:275368 8/20 (40%)
zf-H2C2_2 404..429 CDD:290200 14/25 (56%)
C2H2 Zn finger 420..440 CDD:275368 9/48 (19%)
zf-H2C2_2 433..455 CDD:290200 13/22 (59%)
C2H2 Zn finger 448..466 CDD:275368 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.