DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6654 and lsl-1

Sequence 1:NP_650429.1 Gene:CG6654 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_492621.2 Gene:lsl-1 WormBaseID:WBGene00009937 Length:318 Species:Caenorhabditis elegans

Alignment Length:297 Identity:70/298 (23%)
Similarity:110/298 (37%) Gaps:87/298 (29%)


  Fly   412 NQCNICQKVFTMLSTLRDHMRIHTGEKPFVCNICGKSFTQNANLRQHKLRHSETKSFKCELCPHS 476
            :|||:|.|:|.....|:.|..|||..||::|::||:.|...:|:.:|:..|:....:.|..|...
 Worm    37 HQCNVCNKMFMNYKGLQQHSVIHTDTKPYICDVCGRGFRYKSNMFEHRTVHTGYTPYVCPFCGKQ 101

  Fly   477 FVTKAELTSHARTHTGDKPFECEVCLARFT------------------TSCSLAKHKRKHT---- 519
            |..|..:..|.|||...|. |.|.....::                  ||......::|.:    
 Worm   102 FRLKGNMKKHMRTHVTSKE-ELEAAYRPYSSNRRSSGIIPSDALVIRGTSMPYYNPEKKRSVPKL 165

  Fly   520 --GERP-----YAC--DLCP------------MRFT----ALNVLKNHRRTHTGERP-----YVC 554
              |:.|     ..|  .|.|            ||.|    |.:||:.       .:|     :.|
 Worm   166 LLGKDPSKWVDMICRNQLIPLSSFDDKIMRATMRLTNCHMASDVLEQ-------AKPLEFEIFRC 223

  Fly   555 PFCSKTFTQRGDCQMHQ-RTH---QGERIYICPVCNEEFKSMPEMRSHLAGHE------------ 603
            |.|....:.|.|||:|. .:|   :.|....|..|...|..:...|.|.:.|.            
 Worm   224 PICKCECSGREDCQLHMYASHDKKEAEEPNYCTKCMRVFADVDMYRQHQSYHSRVQLMIRNNELE 288

  Fly   604 ----QHDKRLVHFTFLSNKENGSGALEEELNEMTESA 636
                :.|...:.::.::|.||       |:|.:..||
 Worm   289 MGSPEVDISQICYSMITNTEN-------EMNILKPSA 318

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071
C2H2 Zn finger 331..354 CDD:275368
COG5048 <357..570 CDD:227381 53/210 (25%)
C2H2 Zn finger 360..380 CDD:275368
C2H2 Zn finger 385..406 CDD:275370
C2H2 Zn finger 414..434 CDD:275368 8/20 (40%)
zf-H2C2_2 427..451 CDD:290200 11/24 (46%)
C2H2 Zn finger 442..490 CDD:275368 14/48 (29%)
C2H2 Zn finger 470..487 CDD:275368 5/17 (29%)
zf-H2C2_2 482..507 CDD:290200 7/43 (16%)
C2H2 Zn finger 498..518 CDD:275368 4/38 (11%)
zf-H2C2_2 510..534 CDD:290200 8/49 (16%)
C2H2 Zn finger 526..546 CDD:275368 9/38 (24%)
zf-H2C2_2 539..563 CDD:290200 5/29 (17%)
C2H2 Zn finger 554..574 CDD:275368 8/21 (38%)
C2H2 Zn finger 582..602 CDD:275368 5/20 (25%)
lsl-1NP_492621.2 COG5048 <26..160 CDD:227381 34/124 (27%)
C2H2 Zn finger 39..59 CDD:275368 8/20 (40%)
C2H2 Zn finger 67..87 CDD:275368 6/20 (30%)
zf-C2H2 93..115 CDD:278523 7/22 (32%)
C2H2 Zn finger 95..115 CDD:275368 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.