DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6654 and ztf-23

Sequence 1:NP_650429.1 Gene:CG6654 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_491096.1 Gene:ztf-23 WormBaseID:WBGene00021846 Length:419 Species:Caenorhabditis elegans

Alignment Length:143 Identity:49/144 (34%)
Similarity:72/144 (50%) Gaps:18/144 (13%)


  Fly   442 CNICGKSFTQNANLRQHKLRHSETKS-----FKCELCPHSFVTKAELTSHARTHTGDKPFECEVC 501
            |:..|.:|..           .:|.|     |.|:.|..:|..:::|..|.|||.|.|||:|..|
 Worm   229 CSTSGVAFAD-----------GQTNSGKMGRFSCDRCSRTFKYQSKLDEHRRTHLGVKPFQCHYC 282

  Fly   502 LARFTTSCSLAKHKRKHTGERPYACDL-CPMRFTALNVLKNHRRTHTGERPYVCPFCSKTFTQRG 565
            ..:|:...:|..|.|.||||||:.|.. |..:|.:.:...:|.:||:|||||:|..|.|:||:..
 Worm   283 TRQFSQRGALKTHMRLHTGERPFVCQWECGKQFASSSAKSHHEKTHSGERPYICNVCGKSFTKNS 347

  Fly   566 DCQMH-QRTHQGE 577
            ....| :..|..|
 Worm   348 HVIRHLKNIHNRE 360

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071
C2H2 Zn finger 331..354 CDD:275368
COG5048 <357..570 CDD:227381 46/134 (34%)
C2H2 Zn finger 360..380 CDD:275368
C2H2 Zn finger 385..406 CDD:275370
C2H2 Zn finger 414..434 CDD:275368
zf-H2C2_2 427..451 CDD:290200 3/9 (33%)
C2H2 Zn finger 442..490 CDD:275368 13/53 (25%)
C2H2 Zn finger 470..487 CDD:275368 5/17 (29%)
zf-H2C2_2 482..507 CDD:290200 12/25 (48%)
C2H2 Zn finger 498..518 CDD:275368 6/20 (30%)
zf-H2C2_2 510..534 CDD:290200 12/25 (48%)
C2H2 Zn finger 526..546 CDD:275368 5/21 (24%)
zf-H2C2_2 539..563 CDD:290200 13/24 (54%)
C2H2 Zn finger 554..574 CDD:275368 6/21 (29%)
C2H2 Zn finger 582..602 CDD:275368
ztf-23NP_491096.1 C2H2 Zn finger 251..271 CDD:275368 7/20 (35%)
zf-H2C2_2 264..288 CDD:290200 12/24 (50%)
C2H2 Zn finger 279..299 CDD:275368 6/20 (30%)
zf-H2C2_2 291..317 CDD:290200 12/26 (46%)
C2H2 Zn finger 307..328 CDD:275368 5/21 (24%)
zf-H2C2_2 324..344 CDD:290200 12/20 (60%)
C2H2 Zn finger 336..357 CDD:275368 6/21 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.