DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6654 and ZNF746

Sequence 1:NP_650429.1 Gene:CG6654 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_005250012.1 Gene:ZNF746 HGNCID:21948 Length:660 Species:Homo sapiens

Alignment Length:683 Identity:147/684 (21%)
Similarity:218/684 (32%) Gaps:224/684 (33%)


  Fly    93 SISCPV-----ATTDQAVQTTSWEPDRCTASVQTDAVTTTDAEQNTSLIKSTISVDLDYEGEGEV 152
            :::.|:     |.|.||::          ..:::.|......|..|.:.:..::   |.|.....
Human     4 AVAAPISPWTMAATIQAME----------RKIESQAARLLSLEGRTGMAEKKLA---DCEKTAVE 55

  Fly   153 FDYELPDEPVEKTTSLILQVQGNLKDEKEVVFTQTNVIYEGDDHELEQQIRECNLAIFE---GVD 214
            |..:|  |........:||..|.|:...|               .:|..:|..|..|..   |..
Human    56 FGNQL--EGKWAVLGTLLQEYGLLQRRLE---------------NVENLLRNRNFWILRLPPGSK 103

  Fly   215 NEAEIITVTAPQVT---TRKSAAKLLT-QQENDKH------QTPVG-----SKEEA-RELEKEQV 263
            .|:..:.||...|.   :.:...||.. |:|..||      :|.|.     ||.|. .::|:.:.
Human   104 GESPKVPVTFDDVAVYFSEQEWGKLEDWQKELYKHVMRGNYETLVSLDYAISKPEVLSQIEQGKE 168

  Fly   264 PQSAKRTSRRRGVVKQDVPATP-PSDAEPSP-----------------KQHRLGTQRKLSA---- 306
            |.:    .||.|....|||..| |....|.|                 :|..||.:...:.    
Human   169 PCN----WRRPGPKIPDVPVDPSPGSGPPVPAPDLLMQIKQEGELQLQEQQALGVEAWAAGQPDI 229

  Fly   307 -----------PRAGTVNGPSTTSG-----AATTPELKYHCDRCNAGFAVEKSLMIHRRQKGCIN 355
                       ..||.:: ...|||     :.|.|...:..|           |..|.....|.:
Human   230 GEEPWGLSQLDSGAGDIS-TDATSGVHSNFSTTIPPTSWQTD-----------LPPHHPSSACSD 282

  Fly   356 RNYKCNEC-----------------EKVFVSPDHLAEHQASHGA--------------------- 382
            ...|.|..                 |:|..:|.|..:.:| ||.                     
Human   283 GTLKLNTAASTEADVKIVIKTEVQEEEVVATPVHPTDLEA-HGTLFGPGQATRFFPSPAQEGAWE 346

  Fly   383 -------HNCPECGIRCDSKE-----ALSKHMVQ----------GHKR---NLRNQCNICQKVFT 422
                   ...|..|:|..::.     .||..:.|          |..|   |.|.:..:.....|
Human   347 SQGSSFPSQDPVLGLREPARPERDMGELSPAVAQEETPPGDWLFGGVRWGWNFRCKPPVGLNPRT 411

  Fly   423 MLSTLRDHMRIHTGE---------KPF--VCNICG--KSFTQNANLRQHKLRHSETKSFKCELCP 474
            ....| .:.....||         :||  .|...|  |.|.....|::|.......:.|.|..|.
Human   412 GPEGL-PYSSPDNGEAILDPSQAPRPFNEPCKYPGRTKGFGHKPGLKKHPAAPPGGRPFTCATCG 475

  Fly   475 HSFVTKAELTSHART---HTGDKP--------------------------FECEVCLARFTTSCS 510
            .||..:..|::|.|:   ..|..|                          ..|..|...||....
Human   476 KSFQLQVSLSAHQRSCGAPDGSGPGTGGGGSGSGGGGGGSGGGSARDGSALRCGECGRCFTRPAH 540

  Fly   511 LAKHKRKHTGERPYACDLCPMRFTALNVLKNHRRTHTGERPYVCPFCSKTFTQRGDCQMHQRTH- 574
            |.:|:..||||||:.|..|..|||..:.|.:|.|||||.||:.|..|.|:|.::...:.|||.| 
Human   541 LIRHRMLHTGERPFPCTECEKRFTERSKLIDHYRTHTGVRPFTCTVCGKSFIRKDHLRKHQRNHA 605

  Fly   575 -------QGERIYICPVCNEEFKSMPEMRSHLA 600
                   :|:.:...|...:.||| |..:..||
Human   606 AGAKTPARGQPLPTPPAPPDPFKS-PASKGPLA 637

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071
C2H2 Zn finger 331..354 CDD:275368 4/23 (17%)
COG5048 <357..570 CDD:227381 71/318 (22%)
C2H2 Zn finger 360..380 CDD:275368 6/37 (16%)
C2H2 Zn finger 385..406 CDD:275370 7/36 (19%)
C2H2 Zn finger 414..434 CDD:275368 2/20 (10%)
zf-H2C2_2 427..451 CDD:290200 9/37 (24%)
C2H2 Zn finger 442..490 CDD:275368 14/53 (26%)
C2H2 Zn finger 470..487 CDD:275368 6/17 (35%)
zf-H2C2_2 482..507 CDD:290200 9/54 (17%)
C2H2 Zn finger 498..518 CDD:275368 6/20 (30%)
zf-H2C2_2 510..534 CDD:290200 12/24 (50%)
C2H2 Zn finger 526..546 CDD:275368 9/20 (45%)
zf-H2C2_2 539..563 CDD:290200 13/24 (54%)
C2H2 Zn finger 554..574 CDD:275368 7/20 (35%)
C2H2 Zn finger 582..602 CDD:275368 7/20 (35%)
ZNF746XP_005250012.1 KRAB 111..171 CDD:214630 16/60 (27%)
KRAB_A-box 111..150 CDD:143639 11/39 (28%)
COG5048 <527..604 CDD:227381 33/77 (43%)
zf-C2H2 527..548 CDD:278523 6/21 (29%)
C2H2 Zn finger 528..548 CDD:275368 6/20 (30%)
zf-H2C2_2 540..564 CDD:290200 12/24 (50%)
zf-C2H2 554..576 CDD:278523 9/22 (41%)
C2H2 Zn finger 556..576 CDD:275368 9/20 (45%)
zf-C2H2 582..604 CDD:278523 7/22 (32%)
C2H2 Zn finger 584..604 CDD:275368 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.