DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6654 and ZNF785

Sequence 1:NP_650429.1 Gene:CG6654 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_011544054.1 Gene:ZNF785 HGNCID:26496 Length:418 Species:Homo sapiens

Alignment Length:225 Identity:84/226 (37%)
Similarity:119/226 (53%) Gaps:4/226 (2%)


  Fly   385 CPECGIRCDSKEA-LSKHMVQGHKRNLRNQCNICQKVFTMLSTLRDHMRIHTGEKPFVCNICGKS 448
            |||.   |:.::: ::..:.....|.|.:.|..|.:.|:..|.|..|.|:|:||:||.|..|...
Human   160 CPEF---CNPRQSPMNPWLKDTLTRRLPHSCPDCGRNFSYPSLLASHQRVHSGERPFSCGQCQAR 221

  Fly   449 FTQNANLRQHKLRHSETKSFKCELCPHSFVTKAELTSHARTHTGDKPFECEVCLARFTTSCSLAK 513
            |:|...|.||:..|:..|.:.|..|...|..:..|..|.|.|||:||:.|..|.:|||....||.
Human   222 FSQRRYLLQHQFIHTGEKPYPCPDCGRRFRQRGSLAIHRRAHTGEKPYACSDCKSRFTYPYLLAI 286

  Fly   514 HKRKHTGERPYACDLCPMRFTALNVLKNHRRTHTGERPYVCPFCSKTFTQRGDCQMHQRTHQGER 578
            |:||||||:||:|..|.:||...::|..|||.||||:||.||.|.:.||.......|:|.|...|
Human   287 HQRKHTGEKPYSCPDCSLRFAYTSLLAIHRRIHTGEKPYPCPDCGRRFTYSSLLLSHRRIHSDSR 351

  Fly   579 IYICPVCNEEFKSMPEMRSHLAGHEQHDKR 608
            .:.|..|.:.||....:.:|...|....:|
Human   352 PFPCVECGKGFKRKTALEAHRWIHRSCSER 381

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071
C2H2 Zn finger 331..354 CDD:275368
COG5048 <357..570 CDD:227381 73/186 (39%)
C2H2 Zn finger 360..380 CDD:275368
C2H2 Zn finger 385..406 CDD:275370 4/22 (18%)
C2H2 Zn finger 414..434 CDD:275368 7/20 (35%)
zf-H2C2_2 427..451 CDD:290200 11/24 (46%)
C2H2 Zn finger 442..490 CDD:275368 15/48 (31%)
C2H2 Zn finger 470..487 CDD:275368 5/17 (29%)
zf-H2C2_2 482..507 CDD:290200 13/25 (52%)
C2H2 Zn finger 498..518 CDD:275368 10/20 (50%)
zf-H2C2_2 510..534 CDD:290200 15/24 (63%)
C2H2 Zn finger 526..546 CDD:275368 8/20 (40%)
zf-H2C2_2 539..563 CDD:290200 15/24 (63%)
C2H2 Zn finger 554..574 CDD:275368 7/20 (35%)
C2H2 Zn finger 582..602 CDD:275368 5/20 (25%)
ZNF785XP_011544054.1 KRAB 29..102 CDD:214630
COG5048 <156..372 CDD:227381 82/215 (38%)
C2H2 Zn finger 187..207 CDD:275368 7/20 (35%)
C2H2 Zn finger 215..235 CDD:275368 7/20 (35%)
C2H2 Zn finger 243..263 CDD:275368 6/20 (30%)
C2H2 Zn finger 271..291 CDD:275368 10/20 (50%)
C2H2 Zn finger 299..319 CDD:275368 8/20 (40%)
C2H2 Zn finger 327..347 CDD:275368 7/20 (35%)
C2H2 Zn finger 355..375 CDD:275368 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.