DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6654 and Zfp78

Sequence 1:NP_650429.1 Gene:CG6654 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_017445447.1 Gene:Zfp78 RGDID:1586242 Length:638 Species:Rattus norvegicus

Alignment Length:367 Identity:118/368 (32%)
Similarity:156/368 (42%) Gaps:90/368 (24%)


  Fly   324 TPELKYHCDRCNAGFAVEKSLMIHRR-QKGCINRNYKCNECEKVFVSPDHLAEHQASHGA---HN 384
            |.|..:.|..||..|:....|::|:| ..|  .:.|||.||.|.|..|.|||:||..|..   :.
  Rat   257 THEKLFECKECNKAFSQNSYLIVHQRIHTG--EKPYKCKECTKSFRQPAHLAQHQRIHTGEKPYK 319

  Fly   385 CPECG------------IRCDSKE----------------ALSKHMVQGHKRNLRNQCNICQKVF 421
            |.|||            .||.:.:                :|::|....|.......|..|.|||
  Rat   320 CKECGKAFRDSSTFAQHKRCHNDKRPFQCAECGQAFRYNMSLTRHSRHYHTGEKPFDCADCGKVF 384

  Fly   422 TMLSTLRDHMRIHTGEKPFVCNICGKSFTQNANLRQHKLRHSETKSFKCELC----PHS------ 476
            ::...|..|.||||||||:.||:|||:|...::|..|...|:..|.:||::|    .||      
  Rat   385 SVHIGLTLHRRIHTGEKPYPCNVCGKAFRSGSSLTVHHRIHTGEKPYKCDICGKAFSHSMSLTGH 449

  Fly   477 ----------------------------------------------FVTKAELTSHARTHTGDKP 495
                                                          |...::|.||.|.|||:||
  Rat   450 QRVHSGEKPYTCKECGKAFRQSIHLVVHSRIHTGEKPYECKECGKAFRESSQLASHQRNHTGEKP 514

  Fly   496 FECEVCLARFTTSCSLAKHKRKHTGERPYACDLCPMRFTALNVLKNHRRTHTGERPYVCPFCSKT 560
            |||:.|...|..|..||:|::.||||:||.|:.|...||....|..|:|.||||:||.|..|.|.
  Rat   515 FECKQCGKFFKRSTYLARHQKIHTGEKPYECNECGKTFTHTAYLIRHKRVHTGEKPYKCSECGKA 579

  Fly   561 FTQRGDCQMHQRTHQGERIYICPVCNEEFKSMPEMRSHLAGH 602
            |........|||.|.|||.|.|..|...|::......|.:.|
  Rat   580 FGDGSSRAQHQRLHSGERPYACERCGRAFRTKSSFNCHQSCH 621

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6654NP_650429.1 zf-AD 6..79 CDD:285071
C2H2 Zn finger 331..354 CDD:275368 8/24 (33%)
COG5048 <357..570 CDD:227381 95/300 (32%)
C2H2 Zn finger 360..380 CDD:275368 11/20 (55%)
C2H2 Zn finger 385..406 CDD:275370 8/49 (16%)
C2H2 Zn finger 414..434 CDD:275368 9/20 (45%)
zf-H2C2_2 427..451 CDD:290200 16/24 (67%)
C2H2 Zn finger 442..490 CDD:275368 20/104 (19%)
C2H2 Zn finger 470..487 CDD:275368 8/73 (11%)
zf-H2C2_2 482..507 CDD:290200 14/25 (56%)
C2H2 Zn finger 498..518 CDD:275368 7/20 (35%)
zf-H2C2_2 510..534 CDD:290200 12/24 (50%)
C2H2 Zn finger 526..546 CDD:275368 7/20 (35%)
zf-H2C2_2 539..563 CDD:290200 13/24 (54%)
C2H2 Zn finger 554..574 CDD:275368 7/20 (35%)
C2H2 Zn finger 582..602 CDD:275368 4/20 (20%)
Zfp78XP_017445447.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.