DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Spn88Eb and AT2G35580

Sequence 1:NP_650427.1 Gene:Spn88Eb FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_181101.1 Gene:AT2G35580 AraportID:AT2G35580 Length:374 Species:Arabidopsis thaliana

Alignment Length:314 Identity:93/315 (30%)
Similarity:152/315 (48%) Gaps:47/315 (15%)


  Fly   121 LSSANRIFVDRTINVSNKFNTLLYGATK----ELDFKNDPETGLKEINDWIADKTHNQIRDML-S 180
            :|:||.:::::|:||...|..||..:.|    .:||:...:...:|:|.|:..:|:..|.::| |
plant    92 ISAANGLWIEKTLNVEPSFKDLLLNSYKAAFNRVDFRTKADEVNREVNSWVEKQTNGLITNLLPS 156

  Fly   181 SEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMHKTGA-FKMT-IDEGL 243
            :.:..|.|..:.|||.:..|:|.|||....|....|.:.:..:..|..|  ||| .:.| :.||.
plant   157 NPKSAPLTDHIFANALFFNGRWDSQFDPSLTKDSDFHLLDGTKVRVPFM--TGASCRYTHVYEGF 219

  Fly   244 QSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERALPQ 308
              ::|.|.||   :.:|      :|:| .||.|.||: .|..|..::.||.:..........||.
plant   220 --KVINLQYR---RGRE------DSRS-FSMQIYLPD-EKDGLPSMLERLASTRGFLKDNEVLPS 271

  Fly   309 KI----ELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTADPISLVIDDAQHLAKIKVDE 369
            ..    ||.:|:|:|:...|.:..|...|:              ..|:|:::    |.:.|:|||
plant   272 HSAVIKELKIPRFKFDFAFEASEALKGFGL--------------VVPLSMIM----HKSCIEVDE 318

  Fly   370 VGSTAAAATILLVSRSSRQPDPTK--FNCNHPFVFLIYDEKVDTILFAGVYSDP 421
            |||.||||.... ....|:|.|.|  |..:|||:|::.:.:...:||.|...||
plant   319 VGSKAAAAAAFR-GIGCRRPPPEKHDFVADHPFLFIVKEYRSGLVLFLGQVMDP 371

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 91/310 (29%)
AT2G35580NP_181101.1 plant_SERPIN 8..371 CDD:238998 92/313 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11461
Phylome 1 0.910 0.667 Consistency score
33.020

Return to query results.
Submit another query.