DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Spn88Eb and Serpinb11

Sequence 1:NP_650427.1 Gene:Spn88Eb FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_080143.1 Gene:Serpinb11 MGIID:1914207 Length:388 Species:Mus musculus

Alignment Length:409 Identity:112/410 (27%)
Similarity:198/410 (48%) Gaps:57/410 (14%)


  Fly    40 DFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYF----SSSEQTEREL---------------- 84
            :|.|.:.|::.......|:||||.:|:.||.:...    .|:||.|:.|                
Mouse    10 EFCLDVFKELSSNNVGENIFFSPLTTFYALSMLLLGTRGKSAEQMEKVLHYDSFSGVLKAKTKNS 74

  Fly    85 AQALNLGWALNKQQVLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKF----NTLLYG 145
            ::...:|......:.|:|:...|.           .||.||||:..|:|:...::    ..|...
Mouse    75 SECSQVGVMHPDFRALISHINQQN-----------SLSVANRIYGTRSISFHKQYVRCCEKLYQA 128

  Fly   146 ATKELDFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEE 210
            ..:.:||:...|...|.||.|:.:||:.:|.::.:...|.|.:::||.:|.|.||||.::|:..|
Mouse   129 KLQTVDFELSTEETRKSINAWVKNKTNGKITNLFAKGTIDPSSVMVLVSAIYFKGQWQNKFQKRE 193

  Fly   211 TALKPFFINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMI 275
            |...||.:...:..:|.||::||.||:.|.:..:.|:::|||               :.:.:.||
Mouse   194 TVKAPFHMGVGKSAVVNMMYQTGTFKLAIIKEPEMQVLELPY---------------ANNKLRMI 243

  Fly   276 IILPNSNKISLNRVISRLNADSVKKWF--ERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMF 338
            |:|| ....|::::...||...:::|.  ...:.:::::.:|||....:.:|..:|..:|:..:|
Mouse   244 ILLP-VGTASVSQIEKHLNVKMLREWTNPSNMVEREVDVHIPKFSLSVKYDLNTLLKSLGMRDIF 307

  Fly   339 -TRNATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVF 402
             ..||....::.|. .|.:....|.:.:.|:|.|:.|||||...:| ..|.|...:|..|.||:|
Mouse   308 NVANADLSGMSPDK-GLYLSKVVHKSYVDVNEEGTEAAAATGESIS-VKRLPVTVQFTANCPFLF 370

  Fly   403 LIYDEKVDTILFAGVYSDP 421
            .|:||. ..|||||.::.|
Mouse   371 FIWDES-GNILFAGKFASP 388

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 111/405 (27%)
Serpinb11NP_080143.1 SERPIN 4..388 CDD:294093 111/408 (27%)
RCL. {ECO:0000250} 338..362 10/25 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.